Table 1.
Basic sequence information and antimicrobial activity prediction of ciliate defensins
| Antimicrobial activity pred. | |||||||
|---|---|---|---|---|---|---|---|
| Defensin | Host (accession number) | Scaffold [position] | Sequence (aa)† | Swiss-Prot Best hit (%ID) | ADAM | CAMP‡ | iAMP-2 L |
| LsAMP-1 | Laurentiella sp. (GCA_001272975.2) | LASS02013305.1 [977 - 771] | MVFSKSFLLTLYFFIATILLNLVQADVDVGSCFVFLPDYRSDCNGYCQQRGYKGGHCGSIFNVKCWCET | Heliomicin (64%) | 1.48 | 0.867 | Antifungal |
| LsAMP-2 | Laurentiella sp. (GCA_001272975.2) | LASS02014383.1 [1468 - 1070] | MSINSQIRVLVLFVFLVLTYINQVSADVLIGSCVWGAVDYKSDCSGYCESRGYSGGHCGSFGNVDCWCNVDE | Heliomicin (76%) | 1.93 | 0.975 | Antifungal |
† Sequence identity (ID) and ‡ coverage (cov) ‡ between query/template