Table 4.
Top-selling peptide-based drugs for metabolic disorders in the market (Muttenthaler et al. 2021)
| Peptides | Brand names and their years of market introduction | Clinical indication | Sale in 2021/sales forecast to 2028 (in USD millions) | References |
|---|---|---|---|---|
| Insulin and analogues |
Humulin (1982) Insuman (1997) NovoRapid (1999) Lantus (2000) Novomix (2000) Toujeo (2000) Apidra (2004) Levemir (2004) Humalog (2005) Ryzodeg (2013) Tresiba (2013) Admelog (2017) |
Diabetes | 27,710 | ("Human Insulin Market Size 2021 | Is Anticipated to Reach USD 27.71 Billion and Exhibit a CAGR of 3.4% by 2026," 2021) |
|
Teduglutide (HGDGSFSDEMNTILDNLAARDFINWLIQTKITD) |
Gattex (2012) Revestive (2012) |
Short bowel syndrome | 4,600 | (Short Bowel Syndrome Market—Global Industry Analysis, Size, Share, Trends, Revenue, Forecast 2020 to 2027 2021) |
|
Dulaglutide (HAEGTETSDVSSYLEGQAAKEFIAWLVKGR) |
Trulicity (2014) | Diabetes | 4588.2 | ("Lilly Reports Robust Third-Quarter 2021 Financial Results as Pipeline Success Strengthens Future Growth Potential" 2021) |
|
Glatiramer (AKDY) |
Copaxone (1996) Glatopa (2015) |
Multiple sclerosis | 3,900 | ("Teva Reports Third Quarter 2021 Financial Results,") |
|
Semaglutide (HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) |
Ozempic (2017) Rybelsus (2019) |
Diabetes, obesity | 3,494.72 and 458.33 | (Financial report for the period 1 January 2021 to 30 September 2021, 2021) |
|
Liraglutide (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) |
Victoza (2010) Saxenda (2015) |
Diabetes, obesity | 1,705 and 903.13 | (Financial report for the period 1 January 2021 to 30 September 2021 2021) |
|
Vasopressin (CYFQNCPRG) |
Vasostrict (2014) | Central diabetes insipidus | 785.6 | (Decker 2021) |
|
Teriparatide (SVSEIQLMHQLGKHLQSMERVEWLRKKLQDVHQF) |
Forteo (2002) | Osteoporosis | 650.1 | ("Lilly Reports Robust Third-Quarter 2021 Financial Results as Pipeline Success Strengthens Future Growth Potential" 2021) |
|
Lanreotide (NXCYDWKVCT) |
Somatuline (2007) | Acromegaly | 313.04 | ("Ipsen Delivers Encouraging Sales Growth in the First Quarter of 2021 Despite the Pandemic, and Confirms Its Full-Year Guidance" 2021) |
|
Etelcalcetide (Ac-CDADRDRDRDADRD-NH2) |
Parsabiv (2017) | Hyperparathyroidism | 71 | (Amgen Reports Second Quarter 2021 Financial Results 2021) |