Table 6.
Peptide–drug conjugates in clinical/preclinical trials for Food and Drug Administration approval.
| PDC name (Manufacturer) | Sequence | Drug | Target | Target disease | Status |
|---|---|---|---|---|---|
| ANG1005 (AngioChem) | TFFYGGSRGKRNNFKTEEY (Angiopep-2) | Paclitaxel | LRP-1 | Breast cancer with brain metastasis | Phase III |
| BT1718 (Bicycle Therapeutics) | - | Mertansine (DM1) | Membrane type 1-matrix metalloprotease | Esophageal tumor | Phase II |
| BT8009 (Bicycle Therapeutics) | CP(1Nal)dCM(hArg)DWSTP(HyP)WC | MMAE | Nectin-4 | Metastatic non-small cell cancer | Phase I/II |
| CBX-12 (Cybrexa Therapeutics) | ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTG (pHLIP®) | Exatecan | Low pH | Advanced solid tumors | Phase I/II |
| OPD5 (Oncopeptides AB) | - | Melflufen | Aminopeptidase | Relapsed multiple myeloma | Phase I |
| SBI-1301 (Soricimed Biopharma) | - | Paclitaxel | Transient receptor potential vanilloid subfamily member 6 | Solid tumors | Preclinical |
| SG3299 (Spirogen) | NAVPNLRGDLQVLAQKVARTC | Tesirine | αvβ6 integrin | Pancreatic tumor | Preclinical |
| TH1902 (Theratechnologies) | GVRAKAGVRN(Nle)FKSESY | Docetaxel | Sortilin | Triple-negative breast cancer | Phase I |