Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Peptides used for immunization
| Peptide | Protein (amino acids) | Sequence (NH2→COOH) | Reference |
|---|---|---|---|
| VD4 | MOMP, serovar E (309–338) | C-SATAIFDTTTLNPTIAGAGDVKASAEGQLG | 25a |
| hspm | Mouse hsp60 (458–474) | NEDQKIGIEIIKRALKIa | 16 |
| hspct | Chlamydia hsp60 (435–451) | NEDEQIGARIVLKALSAa | 7 |
| TT | Tetanus toxin (830–844) | QYIKANSKFIGITEL | 21 |
| Pre-S2 | Hepatitis B surface antigen (120–132) | MQWNSTTFHQTLQ | 19 |
Underlined amino acids are homologous in the two hsps.
