Skip to main content
. 2023 Jun 30;12:e86936. doi: 10.7554/eLife.86936

Key resources table.

Reagent type (species) or resource Designation Source or reference Identifiers Additional information
Cell line (human) HEK293 ATCC CRL-1573
Cell line (human) HEK293T ATCC CRL-3216
Cell line (human) HEK293T tauRD P301S v2L FRET Biosensor Produced by Diamond Lab
Stably expresses mClover3 and mCerulean3 tagged tauRD monomers.
Cell line (human) HEK293 DS1 tauRD(P301L-V337M)-YFP Produced by Diamond Lab Stably propagates diffuse tauRD monomers.
Cell line (human) HEK293 DS10 tauRD(P301L-V337M)-YFP Produced by Diamond Lab Stably propagates a unique tau strain.
Cell line (human) HEK293 OFF1::DS10 tauRD(P301L-V337M)-YFP Produced by Diamond Lab Stably propagates a unique tau strain under
a tetracycline-repressible promoter.
Biological sample (human) Alzheimer’s Disease subject brain UT Southwestern Alzheimer’s Disease Center
Biological sample (human) Progressive Supranuclear Palsy subject brain UT Southwestern Alzheimer’s Disease Center
Biological sample (human) Corticobasal Degeneration subject brain UT Southwestern Alzheimer’s Disease Center
Antibody Rabbit polyclonal anti-DnaJC7 Proteintech 11090-1-AP 1:2000 dilution
Antibody Rabbit polyclonal anti-DnaJB6 Proteintech 11707-1-AP 1:2000 dilution
Antibody Rabbit polyclonal anti-Beta-Tubulin Proteintech 10094-1-AP 1:5000 dilution
Antibody Donkey-anti-rabbit HRP- linked F(ab’)2 Cytiva NA9340-1ML 1:5000 dilution (DnaJC7, Beta-Tubulin), 1:4000 dilution (DnaJB6)
Antibody Mouse monoclonal anti-GAPDH Proteintech 60004-1-Ig 1:10000
Antibody Mouse monoclonal anti-Beta-Actin Proteintech 66009-1-Ig 1:5000 dilution
Antibody Goat-anti-mouse H&L (HRP) Abcam ab6789 1:10000 dilution (GAPDH), 1:5000 dilution (Beta-Actin)
Peptide, recombinant protein Human tau 2N4R (Full Length WT-tau) fibrils Produced by Diamond Lab MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQ
TPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTT
AEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATP
RGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTP
GSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRL
Recombinant DNA reagent gRNA-resistant WT DnaJC7 cDNA sequence gBlock from IDT, cloned by VAP The sequence can be found in Materials and methods: Design of a DnaJC7
construct resistant to targeting by used gRNA sequences