Table 2.

Antiviral peptide consensus sequences identified from our AVP database. Three conserved sequence motifs were identified from the 280 sequences composing our AVP database. Structural characteristics were determined via AlphaFold 2.1.1 predictions, seen in Figure 1. “# AVPs” column refers to the number of unique AVP sequences which contributed to the calculated consensus sequence. Peptide weight and theoretical isoelectric points were calculated from ExPASy ProtParam. Abbreviations: CS: consensus sequence ; pI: isoelectric point.

ID	AVP consensus sequences	Characteristics	Peptide size	pI	# AVPs	Related AVPs
CS1	GLLSKLGSLAKKLLKRIVKRIKKFLRNHVVPVIAEHLVGANA	Amphipathic α-helix	42 residues, 4630 Da	11.8	100	BMAPs, caerins, GF-17, LL-37, mucoporins, temporins, uperins
CS2	GVHGGGFGGGGGGFGGNNPNRCLTNGGICWRRRGPCPTKGRQIGNCGHAKVRCCKIR	Glycine-rich motif; cysteine-rich β-sheets (3 sheets)	57 residues, 5810 Da	10.9	31	P9R, polyphemusin II, procambarin, urumin
CS3	RDVALRERRGGQCRGGGPCGESCFRGCCRGICYRGGCSCRYQVRPRWKVCYRNGSCPIIIGRC	Cysteine-rich β-sheets (2 sheets)	63 residues, 7050 Da	9.6	123	Circulins, cycloviolacins, protegrins, retryocyclins, tachyplesins, siamycins