Table 2.

Peptides from amphibians that exert anti-tumor effects by membrane dissolution. (The net charges theoretical values obtained from the prediction of the peptide when it is under neutral conditions (pH = 7), the website is https://www.novopro.cn/tools/calc_peptide_property.html, accessed on 16 July 2023).

Name	Species	Amino Acid Numbers (aa)	Primary Structure	Net Charges	Cancers	References
Ascaphin-8	Ascaphus truei	19	GFKDLLKGAAKALVKTVLF	3	Liver	[52]
Aurein 1.2	Litoria raniformis	13	GLFDIIKKIAESF	0	Leukaemia, Lung, Colon, CNS, Melanoma, Ovarian, Renal, Prostate, Breast	[15]
Citropin 1.1	Litoria citropa	16	GLFDVIKKVASVIGGL	1	Leukaemia, Lung, Colon, CNS, Melanoma, Ovarian, Renal, Prostate, Breast	[50]
Dermaseptin-L1	Hylomantis lemur	32	GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS	2	Liver	[6]
Dermaseptin-PT9	Phyllomedusa tarsius	25	GLWSKIKDAAKTAGKAALGFVNEMV	2	Lung, Glioma, Prostate, Breast, Pancreas	[53]
Dermaseptin-PS1	Paralabidochromis sauvagei	31	ALWKTMLKKLGTVALHAGKAALGAVADTISQ	3.1	Glioma	[54]
LFB	Limnonectes fujianensis	33	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	3.9	Lung, Breast, Glioma, Colon	[55]
Magainin 2	Bombina maxima	23	GIGKFLHSAKKFGKAFVGEIMNS	3.1	Bladder	[51]
Peptide XT-7	Xenopus tropicalis	18	GLLGPLLKIAAKVGSNLL	2	Liver	[52]
Phylloseptin-L1	Hylomantis lemur	18	LLGMIPLAISAISALSKL	1	Liver	[6]
Phylloseptin-PHa	Pithecopus hypochondrialis	19	FLSLIPAAISAVSALANHF	0.1	Lung, Glioma, Prostate, Breast, Colon	[36]
Temporin-1CEa	Rana chensinensis	17	FVDLKKIANIINSIFGK	2	Melanoma, Breast, Liver, Lung, Carcinoma, Colon	[47,48,56]