Skip to main content
. 2005 Mar;137(3):921–930. doi: 10.1104/pp.104.058719

Table I.

Selected candidates of identified S-nitrosylated proteins from Arabidopsis cell cultures and leaves

Cell culture extracts treated with GSNO or GSH and leaf extracts of NO-treated or -untreated Arabidopsis plants were subjected to the biotin switch method and analyzed by nanoLC/MS/MS after trypic digestion. The MASCOT search engine was used to parse MS data to identify proteins from primary sequence databases. The best-matching peptide identifying the protein is given. If there were further peptides found, the number of the peptides is given. Hints confirming that the identified protein is a candidate for S-nitrosylation are given in the right column. The results of two separate experiments of each treatment were summarized in the table. Acc. No., Accession number.

Protein Acc. No. Molecular Mass Identified Peptides (Score) GSNO/NO Identified Peptides (Score) GSH/Untreated Hints to S-Nitrosylation
D
Stress-Related Proteins
    GST, putative NP_565178 25,634 VTEFVSELR (79) NPILPSDPYLR (38) Sies et al. (1998); Ji et al. (2002)
    Hsp 90, putative AAL49788 80,036 ADLVNNLGTIAR (50) + 1 Jaffrey et al. (2001); Fratelli et al. (2002, 2003); Lind et al. (2002); Shenton and Grant (2003)
    Cu/Zn-superoxide dismutase NP_172360 15,088 AVVVHADPDDLGK (55) + 1 Lawler and Song (2002)
Redox-Related Proteins
    Glutathione peroxidase, putative NP_192897 25,568 FAPTTSPLSIEK (65) + 1 FAPTTSPLSIEK (51) Koh et al. (2001)
    Peroxiredoxin-related AAF66133 21,230 AVNVEEAPSDFK (37) Motohashi et al. (2001); Fratelli et al. (2002, 2003); Lind et al. (2002)
    Type 2 peroxiredoxin-related NP_176773 17,417 APIAVGDVVPDGTISFFDENDQLQTASVHSLAAGK (51)
    Glutaredoxin, putative NP_198853 11,749 LVPLLTEAGAIAGK (59) Klatt et al. (2000); Song and Lee (2003)
Signaling/Regulating Proteins
    Elongation factor eEF-1α-chain S08534 49,457 VETGMIKPGMVVTFAPTGLTTEVK (61) + 4 IGGIGTVPVGR (58) +2 Fratelli et al. (2002); Shenton and Grant (2003)
    Elongation factor EF-2 A96602 94,185 AYLPVVESFGFSSQLR (80) + 4 LWGENFFDPATR (43) +2
    Elongation factor 1B α-subunit NP_568375 24,186 TYISGDQLSVDDVK (67) + 1
    Elongation factor 1B γ, putative AAK59587 46,371 VPVLETPEGPIFESNAIAR (40) + 1
    Initiation factor eIF-4A1 CAC43286 41,823 GLDVIQQAQSGTGK (41) GLDVIQQAQSGTGK (38) Lind et al. (2002); Shenton and Grant (2003)
    Initiation factor5A-4-related NP_173985 17,129 TYPQSAGNIR (58)
Cytoskeleton Proteins
    Tubulin α 6 chain JQ1597 49,506 AVFVDLEPTVIDEVR 84) + 1 DVNAAVGTIK (34) +1 Jaffrey et al. (2001)
    Tubulin β 4 chain S68122 49,876 AVLMDLEPGTMDSLR (82) + 2 GHYTEGAELIDSVLDVVR (71) Jaffrey et al. (2001); Lind et al. (2002)
    Actin 2/7 NP_196543 41,709 NYELPDGQVITIGAER (114) + 3 AGFAGDDAPR (53) +1 Dalle-Donne et al. (2000, 2003); Jaffrey et al. (2001); Fratelli et al. (2002, 2003); Lind et al. (2002)
    Actin depolymerizing factor 3-like NP_851227 15,912 YAIFDFDFVSSEGVPR (54)
    Annexin CAA67608 35,757 HYNDEDVIR (48) + 2 DALLANEATK (48) +2 Liu et al. (2002); Kuncewicz et al. (2003)
Metabolic Enzymes
    Fru 1,6-biphosphate aldolase, putative NP_190861 38,516 VSPEVIAEHTVR (85) + 4 LASINVENVETNR (64) +3 Fratelli et al. (2002); Lind et al. (2002); Ito et al. (2003); Shenton and Grant (2003)
    Triosephosphate isomerase T50646 27,138 VASPAQAQEVHDELR (109) + 3 VASPAQAQEVHDELR (68) +3 Fratelli et al. (2002); Ito et al. (2003); Shenton and Grant (2003)
    GAPDH C-subunit NP_187062 36,891 GILGYTEDDVVSTDFVGDNR (92) + 4 AASFNIIPSSTGAAK (46) +3 Mohr et al. (1996, 1999); Klatt et al. (2000); Motohashi et al. (2001); Kuncewicz et al. (2003); Shenton and Grant (2003)
    2-Phosphoglycerate hydrolase (enolase) NP_181192 47,689 VTAAVPSGASTGIYEALELR (86) + 3 Fratelli et al. (2002); Lind et al. (2002); Shenton and Grant (2003)
    Phosphoglycerate kinase NP_178073 42,105 GVTTIIGGGDSVAAVEK (62) + 2 Fratelli et al. (2002)
    Aconitase Q8L784 108,133 INPLVPVDLVIDHSVQVDVAR (43) Navarre et al. (2000)
    SAM synthetase, putative AAO11581 42,769 KPEEVGAGDQGHMFGYATDETPELMPLTHVLATK (70) + 5 FVIGGPHGDAGLTGR (76) +4 Ruiz et al. (1998); Perez-Mato et al. (1999)
    Adenosylhomocysteinase CAB09795 51,447 LVGVSEETTTGVK (48)
    Met synthase NP_197294 84,304 IPSSEEIADR (82) + 1 FALESFWDGK (53) +1 Yamazaki et al. (2004)
    Cys synthase CAA58893 33,842 IDGFVSGIGTGGTITGAGK (59) LFVAIFPSFGER (35)
    ATP synthase CF1 α-chain NP_051044 55,294 LIESPAPGIISR (49) + 2 Eaton et al. (2003)
    ATP synthase CF1 β-chain NP_051066 53,900 YKELQDIIAILGLDELSEEDR (96) + 14 GIYPAVDPLDSTSTMLQPR (108) +6
Proteins Involved in Photosynthetic Processes
    GAPDH precursor, chloroplast JQ1285 42,481 VVDLADIVANNWK (74) + 1 Mohr et al. (1996, 1999); Klatt et al. (2000); Motohashi et al. (2001); Kuncewicz et al. (2003); Shenton and Grant (2003)
    Rubisco large chain NP_051067 52,922 ESTLGFVDLLR (90) + 6 LSGGDHIHAGTVVGK (56) +2 Marcus et al. (2003)
    Rubisco small chain 1a precursor RKMUA1 20,189 IIGFDNTR (45) + 1 IIGFDNTR (58) +1 Motohashi et al. (2001)
    Rubisco activase, large subunit AAA20202 51,948 VPLILGIWGGK (34) GLAYDTSDDQQDITR (81) +3 Zhang and Portis (1999); Zhang et al. (2002)
    PSII P680 47-kD protein NP_051084 56,001 MPTFFETFPVVLVDGDGIVR (85)
    PSII D2 protein,fragment AAO13251 35,220 NILLNEGIR (31) Carlberg et al. (1999)
    PSII oxygen-evolving complex 33 NP_190651 34,998 NTAASVGEITLK (53) + 4
    Rieske Fe-S protein CAC03598 24,334 VLFVPWVETDFR (63)