Table 1. Summary of PTMs Identified during Peptide Mapping of AAV2 with a Relative Abundance ≥1%.
| modification | peptide sequencea | confidence | recovery | average % abundance | SD |
|---|---|---|---|---|---|
| A1 + acetylation | AADGYLPDWLED | 100.00 | 2.50 | 100.00 | 0.00 |
| A203 + acetylation | ATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRT | 100.00 | 43.03 | 97.10 | 0.07 |
| Q100 + NH3 lossb | QERLKEDTSFGGNLGRAVF | 100.00 | 46.94 | 74.64 | 1.52 |
| Q119 + NH3 lossb | QAKKRVLEPLGL | 100.00 | 50.20 | 73.38 | 2.70 |
| N56 + deamidationb | LVLPGYKYLGPFNGLDKGEPVNE | 100.00 | 5.64 | 63.25 | 3.15 |
| M633 + oxidation | AKIPHTDGHFHPSPLMGGFGLKHPPPQIL | 99.99 | 35.20 | 10.24 | 1.14 |
| D624 + succinimide D | AKIPHTDGHFHPSPLMGGF | 100.00 | 49.60 | 5.79 | 0.11 |
| Q606 + NH3 lossb | QDRDVYLQGPIW | 100.00 | 38.19 | 5.44 | 0.25 |
| N702 + deamidationb | IEWELQKENSKRWNPEIQYTSN | 100.00 | 84.25 | 4.70 | 0.16 |
| S148 + phosphorylation | VEEPVKTAPGKKRPVEHSPVEPD | 100.00 | 5.22 | 4.43 | 0.85 |
| D326 + succinimide D | FNIQVKEVTQNDGTTTIANNLTST | 100.00 | 32.30 | 4.26 | 0.22 |
| M557 + oxidation | KVMITDE | 100.00 | 134.22 | 3.49 | 0.62 |
| D344 + succinimide D | VQVFTDSE | 100.00 | 24.81 | 2.77 | 0.36 |
| M433 + oxidation | DRLMNPLIDQYL | 100.00 | 94.54 | 2.23 | 0.02 |
| M401 + oxidation | EYFPSQM | 100.00 | 137.46 | 2.11 | 0.21 |
| W617 + oxidation to kynurenine | LQGPIW | 100.00 | 31.14 | 1.50 | 0.05 |
| N93 + deamidationb | YDRQLDSGDNPYLKYNHADAEF | 100.00 | 41.24 | 1.32 | 0.02 |
| M603 + oxidation | EEIRTTNPVATEQYGSVSTNLQRGNRQAATADVNTQGVLPGMVWQDRD | 100.00 | 16.39 | 1.13 | 0.05 |
a
The peptide sequence shown is that of the most abundant peptide to contain its associated modification.
b
It could not be fully determined if the modifications detected were process-related or a result of the digestion conditions used for peptide mapping. All PTMs above the dashed line have a relative abundance >10%.