FIG. 5.
Effects of terminal extensions of the ComW protein on competence and σX accumulation. The sequences of WT ComW (middle), amino-terminally His-tagged ComW (CP1805; top), and carboxyl-terminally His-tagged ComW (CP1802; bottom). His tags introduced into the wild-type ComW are underlined; boldface residues in N-His-ComW indicate a factor Xa cleavage site; boldface residues in C-His-ComW indicate a V5 epitope. Omitted 53 residues: IEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEK. The corresponding competence phenotype (mean relative number of transformants ± standard deviation) and relative amount of σX (mean and range) observed 15 min after CSP induction are also shown. aa, amino acids.