Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2024 Feb 5.
Published in final edited form as: Peptides. 2023 Dec 29;172:171147. doi: 10.1016/j.peptides.2023.171147

Mitochondrial-derived peptides: Antidiabetic functions and evolutionary perspectives

Satadeepa Kal a, Sumana Mahata b, Suborno Jati c, Sushil K Mahata a,d,*
PMCID: PMC10838678  NIHMSID: NIHMS1960619  PMID: 38160808

Abstract

Mitochondrial-derived peptides (MDPs) are a novel class of bioactive microproteins encoded by short open-reading frames (sORF) in mitochondrial DNA (mtDNA). Currently, three types of MDPs have been identified: Humanin (HN), MOTS-c (Mitochondrial ORF within Twelve S rRNA type-c), and SHLP1–6 (small Humanin-like peptide, 1 to 6). The 12 S ribosomal RNA (MT-RNR1) gene harbors the sequence for MOTS-c, whereas HN and SHLP1–6 are encoded by the 16 S ribosomal RNA (MT-RNR2) gene. Special genetic codes are used in mtDNA as compared to nuclear DNA: (i) ATA and ATT are used as start codons in addition to the standard start codon ATG; (ii) AGA and AGG are used as stop codons instead of coding for arginine; (iii) the standard stop codon UGA is used to code for tryptophan. While HN, SHLP6, and MOTS-c are encoded by the H (heavy owing to high guanine + thymine base composition)-strand of the mtDNA, SHLP1–5 are encoded by the L (light owing to less guanine + thymine base composition)-strand. MDPs attenuate disease pathology including Type 1 diabetes (T1D), Type 2 diabetes (T2D), gestational diabetes, Alzheimer’s disease (AD), cardiovascular diseases, prostate cancer, and macular degeneration. The current review will focus on the MDP regulation of T2D, T1D, and gestational diabetes along with an emphasis on the evolutionary pressures for conservation of the amino acid sequences of MDPs.

Keywords: Mitochondrial peptides, Diabetes, Humanin, MOTS-c, small humanin-like peptides

1. Introduction

Mitochondria, originated from once free-living α-proteobacteria [1-3], are responsible for aerobic generation of ATP: the molecular currency that provides the chemical energy to fuel vital cellular processes [4]. In addition, mitochondria form highly connected networks called mitochondrial reticulum and communicate with the nucleus through retrograde signaling, which allows communication from mitochondria to the nucleus via secondary messengers including Ca2+, ATP/ADP, NAD+/NADH ratios, and other small molecules [5,6]. Due to their bacterial origin, mitochondrial genome inherited bacterial-like traits including circular and double-stranded DNA molecules (mtDNA), which are small (16,569 nucleotides in humans) and compact. mtDNA contains 37 genes that encode 13 subunits of the oxidative phosphorylation (OXPHOS) system, two ribosomal RNAs (rRNAs), and 22 transfer RNAs (tRNAs) [7]. The mtDNA has no introns but a few non-coding nucleotides between adjacent genes and “small open reading frames” (sORF ≤ 300 nucleotides) that encode functional “mitochondrial-derived peptides” (MDPs, 16–38 amino acids long) [8]. Three types of MDPs have so far been identified: Humanin (HN), MOTS-c (Mitochondrial ORF within Twelve S rRNA type-c) and SHLP (small Humanin-like peptide, 1 to 6), expanding the expression of mitochondrial proteome [9]. MDPs, released into the body via paracrine and endocrine pathways, exert diverse functions as cytoprotective agents, such as maintaining cell viability and mitochondrial function under stress; are involved in cellular metabolism and cell survival and act in response to inflammation and oxidative stress [10-12].

Type 2 diabetes (T2D), the most common type of diabetes in adults (>90%), is characterized by hyperglycemia from to progressive loss of insulin secretion from the β-cells superimposed on a background of insulin resistance (IR), leading to relative insulin deficiency. Obesity (body-mass index [BMI]>30 kg/m2) is the strongest risk factor for T2D in East Asian populations [13,14] and is associated with metabolic abnormalities resulting in IR [15]. IR is associated with decreases in insulin-mediated glucose uptake in skeletal muscle and white adipose tissue [16-18], and an increase in hepatic glucose production (HGP) [19]. In contrast, type 1 diabetes (T1D) is characterized by autoimmune destruction of pancreatic β-cells, resulting in absolute insulin deficiency and hyperglycemia and is more common in males [20-23]. T1D accounts for ~5% of diabetes in adults. The prevalence of diabetes globally counts to 536.6 million people as of 2021 and is predicted to reach a 783 million by 2045 [24]. T2D causes mitochondrial dysfunction by reducing bioenergetic capacity and increasing production of reactive oxygen species (ROS) [25,26]. In fact, diabetes is associated with premature death, caused mainly by coronary artery disease [27-29], stroke [30-32], or renal dysfunction [33-36]. The levels of MDPs have been reported to decrease in diabetes, which results in metabolic dyshomeostasis [37]. Administration of MDPs to rodents or exposure of primary/immortalized cell lines with MDPs was shown to increase insulin sensitivity, reduce lipid accumulation, promote mitochondrial biogenesis, and increase energy expenditure [11,38-41].

In the current review, we will provide an up-to-date knowledge on regulation of T2D and T1D by MDPs. We will also highlight the evolutionary pressures on conservation of the amino acid sequences of MDPs.

2. Mitochondrial genome and mitochondrial-derived peptides

The mtDNA was discovered in 1963 by electron microscopy and described as a bacterial-like circular DNA [42,43]. The near complete sequence for human mtDNA was reported in 1981 [7], which was minimally revised in 1999 [7]. MtDNA in humans is an 16,569 bp long double-stranded circular molecule, composed of heavy (H) and complementary light (L) strands, which encode 11 mRNAs that give rise to 13 subunits of the oxidative phosphorylation (OXPHOS) system, 22 transfer RNAs (tRNAs) and two ribosomal RNAs (rRNAs) that are essential for mitochondrial translation. The H-strand of the mtDNA encodes HN, SHLP6, and MOTS-c, while the L-strand encodes SHLP1–5 [44]. mtDNA uses ATA, ATT, and ATG as start codons, AGA and AGG (which code for arginine in nuclear DNA) as stop codons, and UGA (the standard stop codon in nuclear DNA) to code for tryptophan [45-47]. The mitochondrial genome is highly compact as it contains no introns and little non-coding DNA (a ~1 kb sequence known as the non-coding region NCR (mistakenly referred to as the D-loop) and a distant ~30 nucleotide sequence containing the origin of replication for the L-strand OriL) (Fig. 1). The NCR contains one transcription promoter for each strand (light strand promoter – LSP; heavy strand promoter – HSP) as well as the origin of replication for the H-strand (OriH). Almost all mitochondrial genes, including those that encode 12 subunits of the OXPHOS system (the monocistronic ND1–3, ND5, Cytb and COI-III, and the biscistronic ND4/ND4L and ATP6/ATP8), 2 mtRNAs (12 S and 16 S), and 14 mt-tRNAs (F, V, L, I, M, W, D, K, G, R, H, S, L, T), are transcribed from the template of the G-rich H-strand under the control of the HSP. The L-strands serve as a template to produce only 1 mitochondrial messenger RNA (mtRNA) that encodes subunit 6 of NADH dehydrogenase (ND6), and 8 mt-tRNAs (Q, A, N, C, Y, S, E, and P).

Fig. 1. Map of the human mitochondrial genome.

Fig. 1.

NCR (non-coding region), and OriL (origin of replication for the light strand) represent the major non-coding regions. The outer and inner circles represent the heavy (H) and light (L) strands, respectively. The G-rich H-strand encode 12 subunits of the OXPHOS system (ND1–3, ND5, Cytb and COI-III, ND4/ND4L and ATP6/ATP8), 2 mtRNAs (12 S and 16 S), and 14 mt-tRNAs (F, V, L, I, M, W, D, K, G, R, H, S, L, T). The L-strand encode only 1 mitochondrial messenger RNA (mtRNA) that encodes subunit 6 of NADH dehydrogenase (ND6), and 8 mt-tRNAs (Q, A, N, C, Y, S, E, and P). MTRNR2 gene and the encoded peptides including humanin and small humanin-like peptides (SHLPs) such as SHLP1, SHLP2, SHLP3, SHLP4, SHLP5, and SHLP6 are shown on the left. MTRNR1 gene and the encoded peptide MOTS-c are shown on the right.

2.1. MTRNR2 gene and the encoded peptides

Emerging studies indicate that the mtDNA contains sORF, expanding the mitochondrial genetic repertoire [11,12,48-50]. The 16 S ribosomal RNA gene is 1559 nucleotides in length, found within the MTRNR2 gene and spans mtDNA 1671–3229 bp. Humanin (HN), encoded as a 75-bp polycistronic sORF within the 16 S rRNA, was the first sORF to be identified in 2001 in the mtDNA [10,48,51]. In 2016, six additional peptides in the same region of mtDNA as HN (i.e., 16 S rRNA) were identified and named small HN-like peptides (SHLPs):SHLP1 (2490–2561 bp), SHLP2 (2092–2170 bp), SHLP3 (1707–1821 bp), SHLP4 (2446–2524 bp), SHLP5 (2785–2858 bp), and SHLP6 (2992–3051 bp) [11].

2.2. MTRNR1 gene and the encoded peptide

The 12 S 954 bp rRNA gene (MTRNR1) spans from 648–1601 bp and encodes for MOTS-c (Mitochondrial ORF within Twelve S rRNA c: 1343–1393 bp) [12], which was discovered in 2015.

3. Primary sequence, physicochemical properties, and evolutionary pressures in the MDPs

The importance of a peptide is usually determined through loss (knockout or siRNA knockdown of the peptide domain) and gain (supplementation of the peptide to knockout/knockdown organism/cells) of function studies [52-54]. Although attempts have been made on mitochondrial genome editing by CRISPR [55], knockout of mitochondrial ORFs is yet to be achieved. Therefore, HN was knocked down using siRNA, which reduced its antiapoptotic and neuroprotective effects [51, 56]. The other straightforward test to assess the importance of a peptide relies on the evolutionary pressure on preservation of amino acid sequence, which has recently been applied in MDPs [57].

3.1. Gene symbol and primary sequences of MDPs

Below are the gene symbols and the amino acid sequences of the MDPs: MTRNR2: Humanin (MAPRGFSCLLLLTSEIDLPVKRRA).

MTRNR1: MOTS-c (MRWQEMGYIFYPRKLR).

MTRNR2: Small HN-like peptide 1 (SHLP1: MCHWAGGASNTGDARGDVFGKQAG).

MTRNR2: Small HN-like peptide 2 (SHLP2: MGVKFFTLSTRFFPSVQRAVPLWTNS).

MTRNR2: Small HN-like peptide 3 (SHLP3: MLGYNFSSFPCGTISIAPGFNFYRLYFI-WVNGLAKVVW).

MTRNR2: Small HN-like peptide 4 (SHLP4: MLEVMFLVNRRGKICRVPFTFFNLSL).

MTRNR2: Small HN-like peptide 5 (SHLP5: MYCSEVGFCSEVAPTEIFNAGLVV).

MTRNR2: Small HN-like peptide 6 (SHLP6: MLDQDIPMVQPLLKVRLFND).

3.2. Physicochemical properties of MDPs

The physicochemical properties of MDPS (Humanin, MOTS-C. SHLP1. SHLP2. SHLP3. SHLP4. SHLP5, and SHLP6) are provided in Table 1.

Table 1.

Physicochemical properties of MDP and Catestatin (CST).

Gene Peptide Length (amino acids) Molecular weight Extinction co-efficient Absorbance (280 nm, 0.1%) Isoelectric point (pI) Charge at pH 7.0
MTRNR2 Humanin 24 aa 2687.27 Da 0 M−1 cm−1 0.00 9.12 1.22
MTRNR1 MOTS-c 16 aa 2174.62 Da 8480 M−1 cm−1 3.9 10.63 2,83
MTRNR2 SHLP1 24 aa 2393.61 Da 5500 M−1 cm−1 2.3 6.64 −0.49
MTRNR2 SHLP2 26 aa 3017.55 Da 5500 M−1 cm−1 1.82 12.31 2.83
MTRNR2 SHLP3 38 aa 4380.16 Da 15,470 M−1 cm−1 3.53 8.73 1.22
MTRNR2 SHLP4 26 aa 3131.87 Da 0 M−1 cm−1 0.00 11.13 2.22
MTRNR2 SHLP5 24 aa 2565.97 Da 1490 M−1 cm−1 0.58 3.42 −4.39
MTRNR2 SHLP6 20 aa 2385.88 Da 0 M−1 cm−1 0.00 3.93 −1.17
CHGA CST 21 aa 2326.71 Da 1490 M−1 cm−1 0.64 12.03 3.83

3.3. Evolutionary pressures in the MDPs

3.3.1. Humanin

Several cDNAs sharing sequence homology to HN have been identified in plants, nematodes, and rodents demonstrating that HN is evolutionary conserved [48]. Furthermore, amino acid sequence alignments of HN in primates (n = 252), mammals (n = 148) and vertebrates (n = 359) revealed that HN is conserved across vertebrates with seven residues (A2, F6, L9, L10, L18, R22, and R23) showing codon bias (fsyn ≥ 0.5) [57] (Table 2). In vertebrates, two regions are highly conserved, corresponding to the codons for C8, L9 and E15, I16. The authors implied to hypothesize that this conservation might be critical for ribosome function, or could be critical for HN function, or a combination of both [57]. Since methionine has only one codon in the standard DNA code, no fsyn value is provided in Tables 2-6. “Ter” stands for termination, or the stop codon. Values of fsyn ≥ 0.5 are presented in bold font.

Table 2.

Synonymous codon bias in humanin.

Amino acid number 1 2 3 4 5 6 7 8
Human sequence M A P R G F S C
Codon bias in Primates (n = 252) 0.99 0 0 0.33 0.54 0 *
Codon bias in Mammals (n = 148) 0.98 0 0 0.45 0.63 0 *
Codon bias in Vertebrates (n = 359) 0.91 0 0 0.63 0.11 0 *
Amino acid number 9 10 11 12 13 14 15 16
Human sequence L L L L T S E I
Codon bias in Primates (n = 252) 1.0 0.72 0.40 0.09 0 0 * 0
Codon bias in Mammals (n = 148) 1.0 0.57 0.32 0.05 0 0 0 0
Codon bias in Vertebrates (n = 359) 1.0 0.70 0.09 0.09 0.01 0.01 0 0
Amino acid number 17 18 19 20 21 22 23 24 Ter
Human sequence D L P V K R R A Ter
Codon Primates 0.20 0.93 0.02 0 0.44 1.0 0.91 0 0.24
Mammals 0.20 0.86 0.22 0 0.08 0.86 0.35 0 0.19
Vertebrates 0.86 0.85 0.43 0.85 0.33 0.06 0.23 0 0.17
Table 6.

Synonymous codon bias in SHLP6.

Amino acid number 1 2 3 4 5 6 7
Human sequence M L D Q D I P
Codon bias in Primates (n = 242) * * * 0.99 1.0 0 0.10
Codon bias in Mammals (n = 147) * * * 0.88 1.0 0 0.22
Codon bias in Vertebrates(n = 348 * * 1.0 0.62 0.43 0 0.19
Amino acid number 8 9 10 11 12 13 14
Human sequence M V Q P L L K
Codon bias in Primates(n = 242) 0 * 0.41 0 1.0 0.20 0
Codon bias in Mammals(n = 147) * 0.59 0.01 * 0.07 0
Codon bias in Vertebrates(n = 348) * 0.55 0.02 0.73 0.35 0
Amino acid number 15 16 17 18 19 20 Ter
Human sequence V R L F N D Ter
Codon bias in Primates(n = 242) 0.91 0 * * 0 0 *
Codon bias in Mammals(n = 147) 0.20 0 0 0 0 0 0
Codon bias in Vertebrates(n = 348) 0.09 0 0 0 0 0 0

3.3.2. MOTS-c

Amino acid sequence alignments of MOTS-c in primates (n = 254), mammals (n = 178) and vertebrates (n = 348) revealed that MOTS-c has almost no synonymous codon bias (fsyn ≥ 0.5) [57] (Table 3). MOTS-c, however, contains a highly conserved pentapeptide MGYIF in the middle of the sequence.

Table 3.

Synonymous codon bias in MOTS-c.

Amino acid number 1 2 3 4 5 6 7 8 9
Human sequence M R W Q E M G Y I
Codon bias in Primates (n = 252) 0.26 0 0.09 * * * *
Codon bias in Mammals (n = 148) 0.21 0 0.29 * 0.73 0 *
Codon bias in Vertebrates (n = 359) 0.14 0 0.30 0.14 0 0
Amino acid number 10 11 12 13 14 15 16 Ter
Human sequence F Y P R K L R Ter
Codon bias in Primates (n = 252) 0.13 0.32 0.02 0.01 0 0.09 0 0.17
Codon bias in Mammals (n = 148) 0 0.24 0.10 0.05 0 0.09 0.12 0.02
Codon bias in Vertebrates (n = 359) 0.07 0.17 0.08 0.17 0.07 0.13 0.08 0.03

3.3.3. SHLP1

Amino acid sequence alignments of SHLP1 in primates (n = 217) showed poor start codon conservation (33%) and almost no synonymous codon bias (fsyn ≥ 0.5) [57].

3.3.4. SHLP2

Amino acid sequence alignments of SHLP2 in primates (n = 219), mammals (n = 174) and vertebrates (n = 369) revealed poor sequence conservation and almost no synonymous codon bias (fsyn ≥ 0.5) [57]. In primates, SHLP2 displayed an fsyn > 0.5 in only one amino acid (L29). L15 and Y16 showed fsyn values close to 0.5 (Table 4).

Table 4.

Synonymous codon bias in SHLP2.

Amino acid number 1 2 3 4 5 6 7 8 9
Human sequence M G V K F F T L S
Codon bias in Primates (n = 219) 0.31 0.14 0.08 0.18 0 0 0.41 0.43
Codon bias in Mammals (n = 174) 0.38 0.14 0.06 0.09 0.05 0.01 0.11 0.08
Codon bias in Vertebrates (n = 369) 0.19 0.11 0.06 0.17 0.02 0.01 0.11 0.07
Amino acid number 10 11 12 13 14 15 16 17 18
Human sequence T R L F P S V Q R
Codon bias in Primates (n = 219) 0.13 0.05 0 0.07 0.04 0.01 0.06 0.05 0.05
Codon bias in Mammals (n = 174) 0.05 0.03 0.09 0.11 0.13 0.06 0.06 0.03 0.17
Codon bias in Vertebrates (n = 369) 0.14 0.04 0.09 0.09 0.06 0.09 0.12 0.02 0.12
Amino acid number 19 20 21 22 23 24 25 26 Ter
Human sequence A V P L W T N S Ter
Codon bias in Primates (n = 219) 0 0.20 0.26 0.56 0.06 0 0 0 0.17
Codon bias in Mammals (n = 174) 0 0.29 0.21 0.26 0.06 0.13 0.01 0 0.02
Codon bias in Vertebrates (n = 369) 0.13 0.16 0.08 0.15 0.04 0.16 0.06 0.13 0.20

3.3.5. SHLP3

Amino acid sequence alignments of SHLP3 in primates (n = 221) showed poor start codon conservation (18%) and almost no synonymous codon bias (fsyn ≥ 0.5) [57].

3.3.6. SHLP4

Amino acid sequence alignments of SHLP4 in primates (n = 215), mammals (n = 144) and vertebrates (n = 339) revealed highly conserved N-terminal region, with many invariant bases (L2, R11, G12, and L26 in primates; L2, V4, R11, and F21 in mammals; R11, G12, and F19 in vertebrates), and is flanked by amino acids, L2 and R11 [57] (Table 5). Based on the above sequence conservation, the authors suggested the occurrence of purifying selection in mammals [57].

Table 5.

Synonymous codon bias in SHLP4.

Amino acid number 1 2 3 4 5 6 7 8 9
Human sequence M L E V M F L V N
Codon bias in Primates (n = 215) 1.0 0 * * * 0 0 0
Codon bias in Mammals (n = 144) 0.91 0 0.50 * * * * *
Codon bias in Vertebrates (n = 339) 0.39 0.03 0.29 * 0 0 0
Amino acid number 10 11 12 13 14 15 16 17 18
Human sequence R R G K I C R V P
Codon bias in Primates (n = 215) 0 0.50 0.96 0.27 0.01 0.01 0.31 0 0
Codon bias in Mammals (n = 144) * 0.89 0.42 0.22 0.04 0 0.06 0 0.03
Codon bias in Vertebrates (n = 339) 0.01 0.88 0.53 0.27 0.01 0.02 0.22 0 0.24
Amino acid number 19 20 21 22 23 24 25 26 Ter
Human sequence F T F F N L S L Ter
Codon bias in Primates (n = 215) 0 0.01 0.19 0.10 0.07 0 0.07 0.78 0.07
Codon bias in Mammals (n = 144) 0.36 0.29 0.52 0.06 0.09 0 0.13 0.42 0.08
Codon bias in Vertebrates (n = 339) 0.52 0.09 0.25 0.16 0.26 0.07 0.18 0.22 0.07

3.3.7. SHLP5

Amino acid sequence alignments of SHLP5 in primates (n = 216) showed poor start codon conservation (30%) and almost no synonymous codon bias (fsyn ≥ 0.5) [57].

3.3.8. SHLP6

Amino acid sequence alignments of SHLP6 in primates (n = 242), mammals (n = 147) and vertebrates (n = 348) revealed SHLP6 as the most conserved MDP. The following residues showed synonymous codon bias (Q4, D5, L12, and V15 in primates; Q4, D5, and Q10 in mammals; D3, Q4, Q10, and L12 in vertebrates) (Table 6). Unlike other MDPs, the stop codon in SHLP6 is also highly conserved [57]. Like SHLP4, the authors opined that SHLP6 has also undergone purifying selection.

4. Functions of mitochondrial-derived peptides

4.1. HN

The term Humanin (HN) was coined after ‘humanity’ by Hashimoto [48]. HN has a positively charged N-terminal (Met1-Ala2-Pro3-Arg4), central hydrophobic region (Gly5-Phe6-Ser7-Cys8-Leu9-Leu10-Leu11-Leu12-Thr13-Ser14-Glu15-Ile16-Asp17-Leu18), and negatively charged C-terminal (Pro19-Val20-Lys21-Arg22-Arg23-Ala24) (Fig. 2). The above three domains help HN to bind hydrophobic pockets of proteins to form alpha helix [58]. Arg substitution of HN identified two structures – Leu9-Leu11 and Pro19-Val20, which are essential for the secretion of full-length HN [59]. Leu10 plays the most crucial role in this function. Utilizing Ala-scanned HN constructs, Yamagishi et al. identified that Pro3, Ser7, Cys8, Leu9, Leu12, Thr13, Ser14, and Pro19 were essential for the neuroprotective function of HN and that Ser7 and Leu9 were essential for self-dimerization of HN, which are critical for its neuroprotective action [59].

Fig. 2.

Fig. 2.

Functional domains in the primary structure of Humanin and the effects of amino acid substitution on the function of Humanin. AA pos: amino acid position; AA SLC: amino acid single letter code.

4.1.1. HN binding partners, receptors and intracellular signaling

HN binds to many binding partners [60-67], some of which are regarded as receptors for HN. HN signals through binding to both intracellular molecules and putative cell membrane receptors [68-72]. Intracellularly, HN binds to B-cell lymphoma-2 (Bcl-2)-associated X (Bax) [51], Bcl-2-interacting mediator of cell death (Bim) [65], and Bcl-2-homology domain 3 (BH3)-interacting protein (Bid) [64], and inhibits their proapoptotic effects (Fig. 3) [64]. HN is also reported to bind to insulin-like growth factor binding protein 3 (IGFBP-3) and regulates cell survival [65]. Besides the above, HN is shown to bind to actinin 4 [73], a tripartite motif protein TRIM11 [63], and M-phase phosphoprotein 8 (MPP8) [74]. Extracellularly, HN binds to human G protein-coupled formyl peptide receptor-like-1 (FPRL-1) and its murine counterpart FPRL-2 [61]. Of note, FPRL-1 and FPRL-2 are also functional receptors for Amyloid β (Aβ) 42 [61]. HN also binds to a tripartite cytokine-like receptor complex comprising the ciliary neurotrophic factor (CNTF) receptor, the IL-27 receptor WSX1, and glycoprotein (gp) 130 [62]. Activation of these receptors upregulate the Janus Kinase (JAK) 2 and STAT-3 pathways (Fig. 3) [62].

Fig. 3. Binding partners, putative receptors, and intracellular signaling for HN.

Fig. 3.

Intracellularly, HN binds with Bax, Bim, and Bid, and inhibits their proapoptotic effects. Extracellularly, HN binds to two cell surface receptors: formylpeptide receptor like-1 (FPRL-1) and heterotrimeric HN receptor (htHNR) comprising of WSX-1, a subunit for cytokine IL-27, ciliary neurotrophic receptor a subunit (CNTFR), and gp130. FPRL-1 serves as a receptor for both HN and Ab. HN inhibits Ab-induced cell death by competitively inhibiting the binding of Ab to FPRL-1. HN activates JAK2/STAT3-mediated pro-survival signaling by binding to htHNR.

4.1.2. HN mimetics/analogs

The most prominent finding in the structure-function analyses of HN is the substitution of Gly for the 14th Ser residue (HN-S14G), which enhances the neuroprotective activity (10 nM for HN-S14G versus 10 μM for HN) by 1000-fold [48]. Comparable neuroprotective efficacy was achieved when L-Ser14 was substituted to D-Ser14 [75]. The hydrophobic structure of HN made by Leu12 to Ile16 was reported to be disrupted when Gly or D-Ser was substituted for Ser14, which was implicated for their enhanced potencies [75,76]. HN-S14G has also been reported to be more stable than HN [77]. The third HN mimetic constitute a substitution of Phe in the 6th position with Ala (HN-F6A), which changes the binding of HN to IGFBP-3 and enhances its main effect on glucose metabolism and insulin sensitivity [67]. The fourth HN mimetic HN-F6A-S14G (where F6 was changed to A and S14 was changed to G) was found to reduce atherosclerotic plaque size in the proximal aorta of ApoE deficient mice [78].

4.1.3. HN regulation of type 2 diabetes (T2D)

T2D, a heterogenous disease caused by an interaction between genetics (non-modifiable) and environmental (modifiable) factors, increase the risk for insulin resistance, β-cell dysfunction, obesity and ultimately leads to the development of T2D [79-84], which is the most common metabolic disease. T2D is associated with mitochondrial dysfunction (dysregulation of glucose homeostasis and derangement of metabolism) and oxidative stress (caused by hyperglycemia-induced generation of ROS) [85,86]. HN and its mimetic play a significant role in the mitigation of T2D.

4.2. Ex-vivo studies in pancreatic islets

Since impaired glucose-stimulated insulin secretion (GSIS) has been reported in islets obtained from diabetic mice and humans [87,88], the HN mimetic HN-F6A-S14G was tested for its effect on GSIS in isolated islets from 3-mos-old wild-type (WT) and db/db diabetic mice. The exposure of islets to 16 mM glucose plus HN-F6A-S14G (50, 250, or 500 ng/ml) resulted in augmented insulin secretion (by 3-fold) in islets from WT and 2.5-fold in islets from diabetic mice [89], indicating that HN mimetic HN-F6A-S14G potentiates GSIS in diabetic mice.

4.3. In vitro studies in mouse βTC3 cells

Like in pancreatic islets, treatment of βTC3 cells (derived from transgenic mice carrying a hybrid insulin promoter-simian virus-40 tumor antigen gene) with 16 mM glucose plus HN-F6A-S14G (50 ng/ml) caused > 2-fold increase in insulin secretion [89]. HN-F6A-S14G-induced insulin secretion was evident after 60 min exposure to 16 mM glucose, which coincided with HN-F6A-S14G-induced ATP production. The authors did not explain why it took 60 min for HN-F6A-S14G to induce secretion of insulin. Mitochondrial membrane potential was not affected by treatment with HN-F6A-S14G [89].

4.4. In vivo studies in rodents

Intracerebroventricular (ICV) administration of HN in 3-mo-old Sprague-Dawley rats under basal insulin levels (~1.41 ng/ml) during pancreatic-euglycemic clamp studies was reported to cause a significant increase in glucose infusion rate (GIR) to maintain euglycemia [90]. The authors believed that increased GIR was due to enhanced hepatic insulin sensitivity owing to decreased HGP.

Under physiologic hyperinsulinemic clamp conditions (insulin levels 3.9 to 4.6 ng/ml), ICV HN into the third ventricle was reported to cause a significant increase in GIR, which was secondary to suppression of HGP (62% in controls vs ~82% in HN-infused group) and associated with enhanced uptake of glucose in skeletal muscle, which the authors implicated an overall improvement in peripheral insulin sensitivity [90]. The authors reported that HN increased phosphorylation of the insulin sensitive AKT (pAKTS473) and Acetyl-CoA Carboxylase (pACCSer79) in skeletal muscle and phosphorylation of STAT-3 (pSTAT-3 Tyr705) in the hypothalamus, the latter was believed by the authors to be critical for the effects of HN on glucose metabolism [90].

Intravenous administration (at a rate of 0.375 μg/g/hr) of a potent HN mimetic HN-F6A-S14G during a hyperinsulinemic clamp resulted in a significant increase in GIR accompanied with increased glucose uptake in muscle and suppression of HGP. The effects of HN-F6A-S14G on GIR and GSIS were also tested in 3-mo-old male Sprague-Dawley rats in a hyperglycemic clamp study where rats were subjected to 2 h of moderate hyperglycemia (11 mM) followed by glucose infusion for 2 h to maintain the above hyperglycemia. Rats received 20 μg of HN-F6A-S14G as a bolus injection followed by continuous infusion at the rate of 0.07 μg/g/h over 2 h. Under this condition, HN-F6A-S14G caused a moderate increase in GIR (~30%) and a ~2-fold increase in insulin level during the last hour of the clamp [89].

4.5. Studies in humans

Gestational diabetes mellitus (GDM) is defined as hyperglycemia during pregnancy and reflects an early stage of T2D [91,92]. Plasma HN level was reported to be significantly lower in women with GDM, where the HN level was negatively correlated with weight, body-mass index (BMI), and HOMA-IR and might serve as a predictor for the diagnosis of GDM [93]. Like GDM, T2D patients with or without complications also show decreased levels of plasma HN [94]. In primary human hepatocytes, HN was reported to prevent palmitate-induced hepatic lipid accumulation, and insulin resistance (IR) via AMPK-mediated suppression of the mammalian target of rapamycin (mTOR)/ sterol regulatory element-binding protein (SREBP1) pathway [95].

Polycystic ovary syndrome (PCOS), an endocrine disorder, is characterized by hyperandrogenism and IR [96,97]. HN was reported to be downregulated in the ovaries of PCOS patients with IR as compared to patients without IR [98].

A 12-week resistance training intervention (three times with 60 min/ session/week for 12 weeks) has been reported to cause ~32% increase in HN in skeletal muscle in a male population with impaired glucose regulation [99]. The authors, however, did not find any change in serum HN levels after the above intervention. It has also been reported that patients with impaired fasting glucose had decreased levels of HN protein in plasma compared to a healthy control group [100].

4.5.1. HN regulation of Type 1 diabetes (T1D)

Type I Diabetes (T1D), an autoimmune disorder, is characterized by infiltration of immune cells (T cells and macrophages) which release cytokines like IL-β, IFN-γ, TNF-α during this autoimmune response and are important mediators of destruction of pancreatic β-cells [101,102]. Alterations in mitochondrial electron transport [103], mitochondrial reactive oxygen species [103], mitochondrial nitric oxide [104,105], and mitochondrial hyperpolarization of β-cells [106] are also critical for the destruction of pancreatic β-cells, implicating a link between mitochondria and T1D. It is becoming increasingly evident that apoptosis is the principle cause of β-cell death in the development of T1D [107]. Furthermore, evidences indicate β-cell loss by apoptosis after islet graft [108,109].

It has been reported that HN dose-dependently (1 to 1000 nM) protected (by 50%) NIT-1 insulinoma cells from serum starvation (24 h)-induced apoptosis [110]. The authors have shown abolition of the protective effect of HN after co-treatment with a specific STAT3 inhibitor, which implied STAT3 as a crucial player in this anti-apoptotic effect. HN (1000 nM) was also shown to reduce IFNγ (5 ng/ml) and TNFα (5 ng/ml)-induced apoptosis in NIT-1 cells [110]. In humans, plasma HN levels were reported to be elevated in T1D men compared to T1D women [111].

4.5.2. HN regulation of Alzheimer’s disease (AD)

Alzheimer’s disease (AD), a leading cause of dementia around the globe [112], is characterized primarily by the extracellular deposition of amyloid β (Aβ) plaques and intracellular neurofibrillary tangles [113-115]. The disease clinically presents with a slow progression of cognitive and behavioral impairment that severely affects day-to-day life [116,117]. Exposure of primary mouse cortical neurons with Aβ1–42 resulted in 70–80% death of neurons within 72 h as compared to 20–30% death of neurons in non-treated control cells. Treatment of Aβ1–42 exposed primary mouse cortical neurons with HN (10 μm) or its mimetic HN-S14G (10 nM) completely prevented the death of cortical neurons [60]. The authors found that the peptide domain from Pro3 to Pro19 was responsible for neuroprotective action of HN, in which seven residues (Pro3, Leu9, Leu12, Thr13, Ser14 and Pro19) turned out to be essential [60]. Leu9 was later identified as the only amino acid residue that is essential in secretion, dimerization, and maintenance of the intact neuroprotection core domain Pro3-Pro19 [59]. It is becoming increasingly evident that formyl peptide receptor 2 (FPR2) serves as a receptor mediating the Aβ1–42-elicited proinflammatory responses that are implicated in the pathogenic process of AD. FPR2 was identified as a functional receptor of HN and the competitive binding of HN and FPR2 is attributed to the neuroprotective action of HN [118].

It was reported that after 3 and half months of intranasal treatment of 3xTg-AD mice (harboring APPswe, tauP301L, and PS-1M146V) with HN-S14G (10 nmol, 5 days a week), male mice showed significant improvement in spatial learning and memory [119]. In the Morris water maze test, HN-S14G-treated mice showed significant difference between platform quadrant and opposite quadrant. The time spent in the area within 60 cm from the platform location was significantly longer for HN-S14G-treated male mice than for the vehicle-treated control mice, suggesting better cognitive and memory function HN-S14G-treated mice than control [119].

HN-S14G was also reported to ameliorate amnesia caused by muscarinic receptor antagonist [120-122].

4.5.3. HN regulation of healthy aging and lifespan

Aging leads to senescence, or a breakdown of biological processes. In addition, aging exhibits an incapacity to respond to metabolic stress [123] and is deeply associated with the accumulation of mtDNA mutations and the resultant metabolic dysfunction [124,125]. Evidences indicate that serum levels of HN negatively correlates with age and aging-associated diseases like T2D [94,126], AD [127] and cardiovascular diseases [128-130], indicating that supplementation of aging organisms with HN is expected to increase lifespan. Thus, HN-overexpressed transgenic worms experienced a small but significant lifespan expansion [131]. HN promotes healthy aging and increases lifespan by the following mechanisms: (i) by increasing lean body mass and reducing visceral fat [132]; (ii) by promoting the expression of antioxidant defense system proteins by reducing oxidative stress induced by H2O2; (iii) by reducing ROS production; (iv) by restoring chaperone-mediated autophagy in cardiomyocytes and cardiac mitochondria [133-135]; (v) by preserving cardiac function after myocardial infarction in an ischemia-reperfusion injury model by reducing cardiomyocyte cell death and myocardial infarct area [51,136, 137]; (vi) by decreasing macrophage infiltration and inflammation, as well as apoptosis, by interacting with the gp130 subunit of the IL-6 receptor, leading to a reduced in vitro production of pro-inflammatory cytokines, such as IL-1β, IL-6, and TNF-α [138-141].

4.6. Mitochondrial ORF within twelve S rRNA c (MOTS-c)

Consistent with the most common secondary structure in naturally-occurring proteins [142-145], MOTS-c displays an α-helical structure [146], which is amenable to protein folding and protein-protein interactions. Besides structural advantage, MOTS-c interacts with and regulates two kinases that regulate metabolism and age-related diseases such as mechanistic target of rapamycin complex I (mTORC1) [146] and AMP-activated protein kinase (AMPK) [12].

4.6.1. MOTS-c regulation of glucose metabolism

Decreased circulating levels of MOTS-c have been reported in humans suffering from obesity [147], IR [148-150], and T2D [151-153], implicating its potential roles in metabolism. MOTS-c improves glucose tolerance in normal chow diet (NCD)-fed mice during glucose tolerance test, while also improving insulin sensitivity by increasing GIR (by 30%) and insulin-stimulated glucose disposal rate (IS-GDR) as assessed by clamp studies [12]. This is achieved by increased expression and translocation of glucose transporter type 4 (GLUT4) to the plasma membrane in muscle cells [12]. MOTS-c also improves insulin sensitivity in insulin-resistant older male mice by enhancing glucose uptake in soleus muscle [12]. It has been shown that MOTS-c promotes glycolysis by stimulating entry of glucose into cells through AMPK pathway [154]. MOTS-c, however, did not inhibit HGP and do not affect the weight of NCD-fed mice [12]. MOTS-c also reduces D-galactose-induced peripheral lipid accumulation [155] and mitochondrial dysfunction [156], which are key players in the pathophysiology of metabolic disease.

In high fat diet (HFD)-induced obese (DIO) and insulin-resistant mice, MOTS-c prevented hyperinsulinemia and obesity by increasing energy expenditure, markedly reduced fat accumulation in liver, promoted activation of AMPK and expression of GLUT4 in the skeletal muscle [12]. These findings indicate that skeletal muscle is a major target organ of MOTS-c. In addition, hepatotoxicity associated with metformin can be avoided with the use of MOTS-c [157].

4.6.2. MOTS-c regulation of fat metabolism

MOTS-c has been reported to increase β-oxidation of fatty acids to prevent fat accumulation in DIO mice and increase insulin sensitivity by reducing sphingolipid metabolism, monoacylglycerol, and dicarboxylate metabolism [39]. Sphingolipid metabolism is associated with obesity and T2D [158,159]. The important metabolite that MOTS-c decreases in DIO mice is sphingosine 1-phosphate (S1P), which inhibits insulin-mediated AKT signaling in the liver and muscle via S1P receptor [160]. However, in muscle, S1P increases expression of interleukin 6 (IL-6), which inhibits insulin-stimulated activation of insulin receptor substrate (IRS) [161]. Monoacylglycerol and dicarboxylate metabolites were significantly decreased in response to MOTS-c. MOTS-c-induced decrease in monoacylglycerol metabolites included 2-Oleoylglycerol, 1-Linoleolylglycerol, 2-Linoleolylglycerol, and 1-Linolenoylglycerol. Likewise, the dicarboxylate metabolism that were reduced by MOTS-c included the following: Suberate, Sebacate, Undecanedioate, and Tetradecanedioate.

4.6.3. MOTS-c modulation of methionine-folate cycle by activation of AMPK

Folate (vitamin B9) and methionine cycles constitute one-carbon metabolism that are linked by methionine synthase, which is a rate-limiting enzyme that converts homocysteine to methionine using 5-methyltetrahydrofolate (5ME-THF) as a methyl donor and B12 as an essential co-factor [162,163]. 5ME-THF, the most abundant form of activated folate, is dramatically decreased in stably overexpressing MOTS-c cells as well as in response to exogenous treatment with synthetic MOTS-c [12]. Decreased 5ME-THF is associated with 20-fold increase in accumulation of AICAR (5-aminoimidazole-4-carboxamide ribonucleotide), which activates AMPK [164] and stimulate fatty acid oxidation via phosphorylation-induced inactivation of acetyl-CoA carboxylase (ACC) [12]. Inactivation of ACC results in alleviation of allosteric inhibition of carnitine palmitoyltransferase 1 (CPT-1), which is essential for β-oxidation of long chain fatty acids. Activated AMPK increases glucose transporter GLUT4 and the consequent enhancement of glucose uptake in muscle [12,165,166]. Increased phosphorylation of AMPKα (Thr172), ACC (Ser79) and AKT (Ser473), and elevated CPT-1 protein levels by MOTS-c support the above findings.

4.6.4. Nuclear translocation of MOTS-c and regulation of gene expression

MOTS-c rapidly translocates to the nucleus in response to metabolic stress such as, glucose restriction, serum deprivation, and oxidative stress [167]. Nuclear translocation is transient as MOTS-c switches back to being majorly extra-nuclear within 24 hr. Prevention of this nuclear translocation by inhibition of AMPK activity using compound C and siRNA against AMPKα implicates crucial role of AMPK in nuclear translocation of MOTS-c [167]. Furthermore, it has been shown that the hydrophobic domain of MOTS-c (8YIFY11) is required for its nuclear translocation [167]. Upon translocation to the nucleus, MOTS-c directly binds to the DNA sequences of antioxidant response element (ARE) containing promoter regions (5’-TGACNNNGC-3’) of nuclear factor erythroid 2-related factor 2 (NRF2) target genes, including Heme Oxygenase 1 (HMOX1), NAD(P)H Dehrdrogenase Quinone 1 (NQO1), UDP-Glycosyltransferase 1 Family Polypeptide A1 (UGT1A1), UDP-Glycosyltransferase 1 Family Polypeptide A6 (UGT1A6), Thioredoxin (TXN), Ferritin Light Chain (FTL), and Glutathione Peroxidase 2 (GPX2). Of note, NRF2 intersects with AMPK [168] and regulate MOTS-c-related metabolic pathways [169].

4.6.5. MOTS-c regulation of aging and exercise

Aging leads to senescence, or a breakdown of biological processes. In addition, aging exhibits an incapacity to respond to metabolic stress [123] and is deeply associated with the accumulation of mtDNA mutations and the subsequent metabolic dysfunction [124,125]. Like obesity [147], IR [148-150], and T2D [151-153], MOTS-c levels also decrease with age in humans. Middle-aged (45–55 years) and old-aged (70–81 years) individuals display 11% and 21% lower circulating MOTS-c levels compared to younger individuals (18–30 years), respectively [170]. Like humans, aged mice (4 mo vs. 32 mo) also show decreased plasma MOTS-c [12]. Unlike rodents, the levels of MOTS-c in skeletal muscle of the elderly humans were the highest, indicating the levels of MOTS-c in plasma and muscle decrease gradually with age [170]. These findings implicate higher levels of MOTS-c is beneficial to delaying aging.

Oxidized nicotinamide adenine dinucleotide (NAD+), and its reduced form, reduced nicotinamide adenine dinucleotide (NADH), are critical molecules as they support various metabolic functions [171-174]. As a co-enzyme, NAD+ catalyzes cellular redox reactions, and gets reduced to NADH, in many metabolic processes, such as glycolysis, fatty acid beta oxidation, or the tricarboxylic acid cycle [175-177]. NAD+ also acts as a co-substrate for three classes of enzymes: (i) the sirtuins (SIRTs), (ii) the adenosine diphosphate (ADP)-ribose transferases (ARTs) and poly(ADP-ribose) polymerase (PARPs), and (iii) the cyclic ADP-ribose (cADPR) synthases (CD38 and CD157) [178,179]. Since the NAD+/NADH ratio declines with aging in worms, mice, and humans [180,181], restoring NAD+ levels can improve age-related disease conditions [174,179]. MOTS-c extends mouse lifespan by increasing NAD+ levels and activating glycolytic effects via sirtuin 1 (SIRT1) [182]. In addition, MOTS-c restricts the folate/methionine cycle, causing a reduction in methionine metabolism. In rodents, methionine shortage can extend lifespan by 45%, lowers visceral fat and age-related diseases (e.g., cancer), and increases the major antioxidant glutathione (GSH) [183-186].

Exercise is one of the interventions that prevents age-related adverse effects in mice and humans [187-193]. Intraperitoneal administration of MOTS-c has been reported to improve the physical performance of mice of different ages (2, 12, 22 and 23.5 months) and slowed the emergence of age-related deficits over a two-week period [194,195]. Of note, MOTS-c treatment upregulated glycolytic and protein metabolism markers following exercise and led to an enrichment of genes associated with protein regulation/metabolism, cellular metabolism, and oxidative stress response [195].

4.6.6. Association of single nucleotide polymorphism in MOTS-c with T2D

It has been shown that 5–10% of people with East Asian descent have a non-synonymous mitochondrial DNA polymorphism in the MOTS-c coding region, m.A1382C (rs111033358), that causes an amino acid replacement from Lys (K) to Gln (Q) at the 14th amino-acid residue [123]. Meta-analysis with three cohorts (n = 27,527) including Japan multi-institutional collaborative cohort (J-MICC, Saga City), multiethnic cohort (Hawai and California), and Tohoku medical megabank project (Pacific coast of the Tohoku region in Japan) showed that men with C allele of m.A1382C exhibit a significantly higher risk of T2D [152]. Of particular interest, in J-MICC, in sedentary males with C allele of m. A1382C showed higher prevalence of T2D, demonstrating a kinesio-genomic interaction [152]. Treating HFD-fed mice with K14Q MOTS-c has been reported not to confer the metabolic benefits associated with native MOTS-c administration [152]. In vitro and in vivo studies confirm that MOTS-c K14Q is a partially bioinactive form of MOTS-c peptide [152]. Other mtDNA polymorphisms that contribute to T2D risk include MTND1 T4216C and MTND2 A4917G in European population [196], and N9a haplogroup in Asian (Japanese and Korean) population [197].

4.7. SHLP1

Immunoblotting revealed high expression of SHLP1 in mouse heart, kidney, and spleen [11]. Liver, brain, prostate, testis, and muscle also express significant amounts of SHLP1. Preliminary studies on murine derived NIT-1 murine β-cells and human prostate cancer cells 22Rv1 revealed that SHLP1 had no effect on cellular viability [11]. Its specific roles remain to be deciphered and a scope of further studies remain in delineating its exact physiological role.

4.8. SHLP2

Immunoblotting showed highest expression of SHLP2 in mouse liver, kidney, and muscle [11]. Plasma SHLP2 levels were higher in males than in females.

4.8.1. SHLP2 regulation of obesity and insulin sensitization

4.8.1.1. Peripheral actions on obesity, thermogenesis, and insulin sensitivity.

Obese and diabetic patients as well as murine models of obesity and diabetes such as ob/ob and db/db mice show decreased serum levels of SHLP2 [198], implicating that supplementation of obese mice with SHLP2 would improve insulin sensitivity. Thus, three weeks of treatment of DIO mice with intraperitoneal SHLP2 (2 μg/g body weight, once daily) caused the following phenotypes: (i) protection of mice against diet-induced increase in body weight, (ii) decrease in total body fat mass and circulating leptin levels, (iii) reduction in the size of inguinal and epididymal white adipose tissues, and (iv) profound decrease in HFD-induced hepatic steatosis [198]. Furthermore, SHLP2 treatment resulted in a significant lowering of blood glucose levels and improved glucose tolerance and sensitivity [198]. SHLP2 in presence of insulin promoted differentiation of 3T3-L1 murine pre-adipocytes, indicating its insulin-sensitizing effect in adipose tissue [11]. SHLP2 not only enhanced cell viability and decreased apoptosis in both NIT-1β and 22Rv1 cells but promoted cell proliferation in NIT-1β cells. Furthermore, SHLP2 treatment of C57BL/6 mice (2 μg/g body weight, BID, IP) for 5 days though had no significant effects on plasma insulin, IL-6, or monocyte chemoattractant protein-1 (MCP-1), but increased plasma leptin level without affecting body weight and food intake [11].

In addition, systemic SHLP2 administration also caused robust increase in O2 consumption (VO2), CO2 production (VCO2) as well as heat generation by increasing expression of the genes involved in inguinal brown adipose tissue (iBAT) thermogenesis including peroxisome proliferator-activated receptor-gamma coactivator-1 alpha (Pgc1α), iodothyronine deiodinase 2 (Dio2), PR domain-containing protein 16 (Prdm16), and nuclear respiratory factor 1 (Nrf1). SHLP2 also showed a significant reduction in daily food intake [198], which was attributed to a reduction in the expression of orexigenic neuropeptides in the hypothalamus such as agouti-related peptide (Agrp) and neuropeptide Y (Npy). Of note, SHLP2 was shown to cross the blood-brain barrier.

4.8.1.2. Peripheral effects on sphingolipid metabolism.

Metabolomic studies in DIO mice after three days of treatment with SHLP2 (2.5 μg/g body weight; twice daily) revealed significant alterations in the concentrations of lipid metabolites in plasma [199]. Since feeding HFD increases sphingomyelin levels in liver, adipose tissue and plasma, SHLP2’s effects were tested in DIO mice, which showed significant decrease in plasma levels of sphingolipids such as sphinganine, sphingomyelin, sphinganine-1-phosphate, glucosyl N-stearoyl sphingosine, and glycosyl N-palmitoyl sphingosine [199].

4.8.1.3. Peripheral effects on mitochondrial metabolism.

In human prostate cancer cells (22Rv1), SHLP2 caused significant increase in mitochondrial oxygen consumption rate (OCR) and cellular ATP, indicating enhanced mitochondrial metabolism by SHLP2. Pre-incubation of murine β-cells (NIT-1) and 22Rv1 cells with SHLP2 overnight resulted in significant suppression of serum-starvation-dependent formation of ROS, suggesting a cytoprotective role of SHLP2. In addition, SHLP2 fully blocked staurosporine-induced apoptosis in NIT-1β cells.

4.8.2. Central actions of SHLP2 on obesity, thermogenesis, and insulin sensitivity

Like systemic administration, ICV administration of SHLP2 (3 μg) into third ventricle also protected the male mice from HFD-induced obesity, increased expression of thermogenic genes and uncoupling protein 1 (UCP1) in inguinal brown adipose tissue (iBAT), and improved glucose tolerance [39]. Therefore, it was thought that the thermogenic and anorexigenic effects of SHLP2 might be mediated through the central nervous system (CNS) [39].

Continuous ICV infusion of SHLP2 (at a rate of 0.16 ng/g/min) into conscious Sprague Dawley rats significantly improved insulin sensitivity by increasing GIR, suppressing HGP, and increasing peripheral glucose uptake in hyperinsulinemic-euglycemic clamp studies [11].

4.8.3. SHLP2 regulation of macular degeneration

Expression of MDP-coding MT-RNR2 gene along with all five oxidative phosphorylation (OXPHOS) complex I-V protein subunits have been reported to be downregulated in human transmitochondrial age-related macular degeneration (AMD) ARPE-19 cell model. However, treatment of AMD cells with SHLP2 resulted in the following changes: (i) restoration of the normal levels of OXPHOS complex protein subunits, (ii) prevention of loss of viable cells and mitochondria, (iii) induction of anti-apoptotic effects, and (iv) attenuation of amyloid-β-induced cellular and mitochondrial toxicity [200].

4.8.4. SHLP2 regulation of Parkinson’s disease (PD)

The substantia nigra of PD patients show deficiencies of mitochondrial respiratory chain complex I activity [201]. Attenuated risk of PD has been reported in patients carrying mtDNA SNP (m .2158 T > C where lysine 4 is changed to arginine). Further studies revealed that K4R SHLP2 is not only more stable than WT SHLP2, but also more potently inhibited PD toxin (MPP+)-induced apoptosis in neuronal cells [202].

4.8.5. SHLP2 regulation of AD

Increased Aβ1–42 is the hallmark of AD [203]. Exposure of primary cortical neurons with 0.1 or 10 μM SHLP2 prevented Aβ1–42-induced neuronal cell death, implicating association of SHLP2 with AD [11].

4.8.6. SHLP2 regulation of prostate cancer

Since SHLP2 levels were found to be nearly halved in prostate cancer patients, SHLP2 levels are used as a biomarker for cancer patients [204].

4.9. SHLP3

Immunoblotting showed highest expression of SHLP3 in mouse brain, and spleen [11]. Kidney, prostate, and testis also express significant amounts of SHLP3. An immunoassay to measure SHLP3 is yet to be developed.

Like SHLP2, SHLP3 increases cell viability, decreases cellular apoptosis in both NIT-1β and 22Rv1 cells, increases mitochondrial functions by increasing mitochondrial OCR, cellular ATP, and decreasing the ability to produce ROS, implicating its cytoprotective nature [11]. Unlike SHLP2, SHLP3 did not exert insulin-sensitizing effects in vivo. Like SHLP2, SHLP3 increases plasma leptin levels without altering food intake and body weight. As a sharp contrast to SHLP2, SHLP3 increases proinflammatory cytokines IL-6 and MCP-1, which possibly explains the lack of an in vivo insulin-sensitizing effect of SHLP3 [11].

4.10. SHLP4

Immunoblotting showed highest expression of SHLP4 in mouse liver, spleen, and prostate [11]. In addition, brain, kidney, and testis also show detectable amounts of SHLP4. Like SHLP2, SHLP4 also increase cellular proliferation in murine NIT-1 cells.

4.11. SHLP5

SHLP5 is the least studied SHLP till date. Apart from its peptide sequence not much has been elucidated in any scientific study hitherto.

4.12. SHLP6

Immunoblotting showed significant expression of SHLP6 in mouse heart, liver, and kidney [11]. A sharp contrast to SHLP2 and SHLP3, SHLP6 increased apoptosis in both NIT1 and 22Rv1 cells [11,38]. Plasma levels of SHLP6 increased significantly after acute exercise in young human males, which returned to baseline during recovery [205]. Like humanin, short-term high intensity interval training (HIIT) lead to an overall lower plasma concentration of SHLP6 but did not change the response to exercise [205].

5. Newly discovered mitochondrial microproteins

Two mitochondrial microproteins have recently been identified: SHMOOSE (Small Human Mitochondrial ORF Over SErine tRNA; 58 amino acids) [206] and MTALTND4 (mitochondrial alternative ND4 protein; 99 amino acids) [207]. SHMOOSE binds to intermembrane space protein Mic60 (mitofilin) and modifies mitochondrial biology including increase in neural cell metabolic activity (by 10–20%) and increase in basal oxygen consumption rate by ~20%. Furthermore, SHMOOSE expression was found to be high (~15% greater compared control) in AD patient brains, linking its association AD pathophysiology [206]. In addition, treatment of neuronal cells (stressed with oligomerized amyloid beta) with SHMOOSE has been reported to protect those cells from death [206]. Like SHMOOSE, MTALTND4 also modulates mitochondrial function [207].

6. Conclusion and future perspectives

Mitochondria are the “powerhouse of the cell” as they are the main sites of ATP (energy currency of the cell) production [208]. Besides energy production, this important sub-cellular organelle through its MDPs (e.g., MOTS-c) have developed extensive retrograde signaling networks to communicate with the nuclear genome, other intracellular organelles, and potentially neighboring cells or organs [209]. Therefore, mitochondrial dysfunction is believed to be a key player in the pathophysiology of metabolic diseases, including obesity, IR and T2D [156]. Consistent with this hypothesis, it has been reported that T2D patients show reduced NADH2-O2 oxidoreductase activity (attributed to complex I) and structural mitochondrial aberrations coupled with decreased subsarcolemmal mitochondrial function [210,211]. Other studies using muscle biopsy samples from patients with T2D and from individuals with a positive family history of T2D revealed downregulation of genes that encode proteins involved in oxidative metabolism [212,213].

Circulating levels of MDPs (HN and MOTS-c) show negative correlation in humans suffering from obesity [147], IR [148-150], T2D [94,100,151-153], and GDM [93], implicating their crucial roles in metabolism. In addition, in humans, plasma levels of MDPs (HN, MOTS-c and SHLP2) show negative correlation with aging and age-related diseases like AD [214,215], indicating their critical roles in promoting lifespan and health. Based on the multifaceted actions, MDPs pave a new conceptual way for the treatment of metabolic (e.g., obesity, steatosis, and T2D) and age-related diseases like AD. Clinical trials to test the therapeutical potential of an MDP, MOTS-c is ongoing but currently limited, including a clinical trial using a MOTS-c analog for fatty liver and obesity (clinical trial #NCT03998514). Further studies are required to better understand the basic molecular mechanisms of MDPs, their stabilities in biological systems, oral bioavailability, and relevance to a broad range of diseases and conditions.

Based on a recent synonymous codon bias study in vertebrates [57], it was revealed that HN and SHLP6 exhibited strong synonymous codon bias and sequence conservation. As a sharp contrast, SHLP1, SHLP2, SHLP3, and SHLP5 showed no significant synonymous codon bias, and the sequences are poorly conserved. Although MOTS-c and SHLP4 lack significant synonymous codon bias, they contain highly conserved N-terminal regions. Sequence homology analyses of MOTS-c in 14 mammalian species revealed the following conservation: M1, M6, G7, and Y8 (100%); I9 and F10 (~94%); R2 (~44%); W3 (~82%); Q4 (~37%), E5 (~94%), and Y11 (~87%) [12]. In this context, it should be pointed out that like MDPs, sequence alignment of a nuclear-encoded Chromogranin A (CgA) derived peptide Catestatin (CST: human CgA352–372) in 53 mammalian species belonging to 8 orders revealed > 80% homology in 52 species, except in Platypus (lowest in the mammalian phylogenetic tree) where the homology with the primates (highest in the mammalian phylogenetic tree was >58%), indicating that CST is also highly conserved in mammals [216-218]. Besides sequence conservation, MDPs and CST exhibit several comparable features: length (MDP: 16–38 amino acids versus CST: 21 amino acids); isoelectric point (MDPs: 8.73 - 12.31 (except SHLP1 and SHLP6) versus CST: 12.03); charge at pH 7.0: (MDPs: 1.22 - 2.83 versus CST: 3.83). In addition to the evolutionary conservation and comparable physicochemical properties, MDPs and CST exhibit comparable anti-diabetic [12,19,151,157,219], anti-oxidative [133,220-222], anti-inflammatory [19,223,224], anti-apoptotic [225,226], cardioprotective [224,227-231], and neuroprotective effects [59,62,232]. Therefore, it is reasonable to assume that retrograde signaling of MDPs can regulate nuclear encoded genes such as CgA to maintain health and diseases.

Acknowledgements

This work was supported by the National Institutes of Health (1 R21 AG080246–01, 1 R21 AG078635–01A1, and 1 I21 RX004398–01A1 to S.K.M.). S.J. is supported by AFTD Holloway Postdoctoral Fellowship (Award #2020–02)

Footnotes

CRediT authorship contribution statement

Sushil K. Mahata: Writing – original draft, Funding acquisition, Conceptualization. Sumana Mahata: Writing – review & editing, Visualization. Suborno Jati: Writing – review & editing. Satadeepa Kal: Writing – original draft, Resources.

Data availability

No data was used for the research described in the article.

References

  • [1].Esser C, Ahmadinejad N, Wiegand C, et al. , A genome phylogeny for mitochondria among alpha-proteobacteria and a predominantly eubacterial ancestry of yeast nuclear genes, Mol. Biol. Evol 21 (9) (2004) 1643–1660. [DOI] [PubMed] [Google Scholar]
  • [2].Andersson SG, Zomorodipour A, Andersson JO, et al. , The genome sequence of Rickettsia prowazekii and the origin of mitochondria, Nature 396 (6707) (1998) 133–140. [DOI] [PubMed] [Google Scholar]
  • [3].Andersson SG, Karlberg O, Canback B, Kurland CG, On the origin of mitochondria: a genomics perspective, Philos. Trans. R. Soc. Lond. B Biol. Sci 358 (1429) (2003) 165–177, discussion 177-169. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [4].Mitchell P, Coupling of phosphorylation to electron and hydrogen transfer by a chemi-osmotic type of mechanism, Nature 191 (1961) 144–148. [DOI] [PubMed] [Google Scholar]
  • [5].Zhang Q, Wu X, Chen P, et al. , The mitochondrial unfolded protein response is mediated cell-non-autonomously by retromer-dependent wnt signaling, Cell 174 (4) (2018) 870–883, e817. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [6].Durieux J, Wolff S, Dillin A, The cell-non-autonomous nature of electron transport chain-mediated longevity, Cell 144 (1) (2011) 79–91. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [7].Anderson S, Bankier AT, Barrell BG, et al. , Sequence and organization of the human mitochondrial genome, Nature 290 (5806) (1981) 457–465. [DOI] [PubMed] [Google Scholar]
  • [8].Taanman JW, The mitochondrial genome: structure, transcription, translation and replication, Biochim Biophys. Acta 1410 (2) (1999) 103–123. [DOI] [PubMed] [Google Scholar]
  • [9].Kim SJ, Mehta HH, Wan J, et al. , Mitochondrial peptides modulate mitochondrial function during cellular senescence, Aging 10 (6) (2018) 1239–1256. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [10].Lee C, Yen K, Cohen P, Humanin: a harbinger of mitochondrial-derived peptides? Trends Endocrinol. Metab 24 (5) (2013) 222–228. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [11].Cobb LJ, Lee C, Xiao J, et al. , Naturally occurring mitochondrial-derived peptides are age-dependent regulators of apoptosis, insulin sensitivity, and inflammatory markers, Aging (Albany N. Y) 8 (4) (2016) 796–809. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [12].Lee C, Zeng J, Drew BG, et al. , The mitochondrial-derived peptide MOTS-c promotes metabolic homeostasis and reduces obesity and insulin resistance, Cell Metab. 21 (3) (2015) 443–454. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [13].Carey VJ, Walters EE, Colditz GA, et al. , Body fat distribution and risk of non-insulin-dependent diabetes mellitus in women. The Nurses’ Health Study, Am. J. Epidemiol 145 (7) (1997) 614–619. [DOI] [PubMed] [Google Scholar]
  • [14].Bellou V, Belbasis L, Tzoulaki I, Evangelou E, Risk factors for type 2 diabetes mellitus: An exposure-wide umbrella review of meta-analyses, PLoS One 13 (3) (2018) e0194127. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [15].Sinha R, Dufour S, Petersen KF, et al. , Assessment of skeletal muscle triglyceride content by (1)H nuclear magnetic resonance spectroscopy in lean and obese adolescents: relationships to insulin sensitivity, total body fat, and central adiposity, Diabetes 51 (4) (2002) 1022–1027. [DOI] [PubMed] [Google Scholar]
  • [16].Shulman GI, Rothman DL, Jue T, Stein P, DeFronzo RA, Shulman RG, Quantitation of muscle glycogen synthesis in normal subjects and subjects with non-insulin-dependent diabetes by 13C nuclear magnetic resonance spectroscopy, N. Engl. J. Med 322 (4) (1990) 223–228. [DOI] [PubMed] [Google Scholar]
  • [17].Rothman DL, Magnusson I, Cline G, et al. , Decreased muscle glucose transport/phosphorylation is an early defect in the pathogenesis of non-insulin-dependent diabetes mellitus, Proc. Natl. Acad. Sci. USA 92 (4) (1995) 983–987 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [18].Cline GW, Petersen KF, Krssak M, et al. , Impaired glucose transport as a cause of decreased insulin-stimulated muscle glycogen synthesis in type 2 diabetes, N. Engl. J. Med 341 (4) (1999) 240–246. [DOI] [PubMed] [Google Scholar]
  • [19].Ying W, Mahata S, Bandyopadhyay GK, et al. , Catestatin inhibits obesity-induced macrophage infiltration and inflammation in the liver and suppresses hepatic glucose production, leading to improved insulin sensitivity, Diabetes 67 (5) (2018) 841–848. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [20].Ostman J, Lonnberg G, Arnqvist HJ, et al. , Gender differences and temporal variation in the incidence of type 1 diabetes: results of 8012 cases in the nationwide Diabetes Incidence Study in Sweden 1983-2002, J. Intern Med 263 (4) (2008) 386–394. [DOI] [PubMed] [Google Scholar]
  • [21].Del Chierico F, Rapini N, Deodati A, Matteoli MC, Cianfarani S, Putignani L, Pathophysiology of Type 1 Diabetes and Gut Microbiota Role, Int J. Mol. Sci 23 (23) (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [22].Richardson SJ, Pugliese A, 100 YEARS OF INSULIN: Pancreas pathology in type 1 diabetes: an evolving story, J. Endocrinol 252 (2) (2021) R41–R57. [DOI] [PubMed] [Google Scholar]
  • [23].Giwa AM, Ahmed R, Omidian Z, et al. , Current understandings of the pathogenesis of type 1 diabetes: genetics to environment, World J. Diabetes 11 (1) (2020) 13–25. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [24].Sun H, Saeedi P, Karuranga S, et al. , IDF Diabetes Atlas: Global, regional and country-level diabetes prevalence estimates for 2021 and projections for 2045, Diabetes Res Clin. Pr 183 (2022) 109119. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [25].Gao CL, Zhu C, Zhao YP, et al. , Mitochondrial dysfunction is induced by high levels of glucose and free fatty acids in 3T3-L1 adipocytes, Mol. Cell Endocrinol 320 (1-2) (2010) 25–33. [DOI] [PubMed] [Google Scholar]
  • [26].Lowell BB, Shulman GI, Mitochondrial dysfunction and type 2 diabetes, Science 307 (5708) (2005) 384–387. [DOI] [PubMed] [Google Scholar]
  • [27].Aronson D, Edelman ER, Coronary artery disease and diabetes mellitus, Cardiol. Clin 32 (3) (2014) 439–455. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [28].Orchard TJ, Costacou T, Kretowski A, Nesto RW, Type 1 diabetes and coronary artery disease, Diabetes Care 29 (11) (2006) 2528–2538. [DOI] [PubMed] [Google Scholar]
  • [29].Lee WL, Cheung AM, Cape D, Zinman B, Impact of diabetes on coronary artery disease in women and men: a meta-analysis of prospective studies, Diabetes Care 23 (7) (2000) 962–968. [DOI] [PubMed] [Google Scholar]
  • [30].Alloubani A, Saleh A, Abdelhafiz I, Hypertension and diabetes mellitus as a predictive risk factors for stroke, Diabetes Metab. Syndr 12 (4) (2018) 577–584. [DOI] [PubMed] [Google Scholar]
  • [31].Hewitt J, Castilla Guerra L, Fernandez-Moreno Mdel C, Sierra C, Diabetes and stroke prevention: a review, Stroke Res Treat. 2012 (2012) 673187. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [32].Tun NN, Arunagirinathan G, Munshi SK, Pappachan JM, Diabetes mellitus and stroke: a clinical update, World J. Diabetes 8 (6) (2017) 235–248. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [33].Zheng Y, Ley SH, Hu FB, Global aetiology and epidemiology of type 2 diabetes mellitus and its complications, Nat. Rev. Endocrinol 14 (2) (2018) 88–98. [DOI] [PubMed] [Google Scholar]
  • [34].Dwyer JP, Parving HH, Hunsicker LG, Ravid M, Remuzzi G, Lewis JB, Renal dysfunction in the presence of normoalbuminuria in type 2 diabetes: results from the DEMAND Study, Cardiorenal Med. 2 (1) (2012) 1–10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [35].Retnakaran R, Cull CA, Thorne KI, Adler AI, Holman RR, Group US, Risk factors for renal dysfunction in type 2 diabetes: U.K. Prospective, Diabetes Study 74. Diabetes 55 (6) (2006) 1832–1839. [DOI] [PubMed] [Google Scholar]
  • [36].Braunwald E, Diabetes, heart failure, and renal dysfunction: the vicious circles, Prog. Cardiovasc Dis 62 (4) (2019) 298–302. [DOI] [PubMed] [Google Scholar]
  • [37].Alis R, Lucia A, Blesa JR, Sanchis-Gomar F, The role of mitochondrial derived peptides (MDPs) in metabolism, J. Cell Physiol 230 (12) (2015) 2903–2904. [DOI] [PubMed] [Google Scholar]
  • [38].Kim SJ, Xiao J, Wan J, Cohen P, Yen K, Mitochondrially derived peptides as novel regulators of metabolism, J. Physiol 595 (21) (2017) 6613–6621. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [39].Kim SJ, Miller B, Mehta HH, et al. , The mitochondrial-derived peptide MOTS-c is a regulator of plasma metabolites and enhances insulin sensitivity, Physiol. Rep 7 (13) (2019) e14171. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [40].Ruiz D, Santibanez M, Lavin BA, Berja A, Montalban C, Vazquez LA, Evolution of Mitochondrially Derived Peptides Humanin and MOTSc, and Changes in Insulin Sensitivity during Early Gestation in Women with and without Gestational Diabetes, J. Clin. Med 11 (11) (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [41].Nashine S, Kenney MC, Effects of mitochondrial-derived peptides (MDPs) on mitochondrial and cellular health in AMD, Cells 9 (5) (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [42].Nass S, Nass MM, Intramitochondrial Fibers with DNA Characteristics. Ii. Enzymatic and Other Hydrolytic Treatments, J. Cell Biol 19 (3) (1963) 613–629. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [43].Nass MM, Nass S. Intramitochondrial Fibers with DNA Characteristics. I. Fixation and Electron Staining Reactions, J. Cell Biol 19 (3) (1963) 593–611. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [44].Miller B, Kim SJ, Kumagai H, et al. , Peptides derived from small mitochondrial open reading frames: Genomic, biological, and therapeutic implications, Exp. Cell Res 393 (2) (2020) 112056. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [45].Bezerra AR, Guimaraes AR, Santos MA, Non-Standard Genetic Codes Define New Concepts for Protein Engineering, Life (Basel) 5 (4) (2015) 1610–1628. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [46].Sengupta S, Yang X, Higgs PG, The mechanisms of codon reassignments in mitochondrial genetic codes, J. Mol. Evol 64 (6) (2007) 662–688. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [47].Swart EC, Serra V, Petroni G, Nowacki M, Genetic Codes with No Dedicated Stop Codon: Context-Dependent Translation Termination, Cell 166 (3) (2016) 691–702. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [48].Hashimoto Y, Niikura T, Tajima H, et al. , A rescue factor abolishing neuronal cell death by a wide spectrum of familial Alzheimer’s disease genes and Abeta, Proc. Natl. Acad. Sci. USA 98 (11) (2001) 6336–6341. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [49].Saghatelian A, Couso JP, Discovery and characterization of smORF-encoded bioactive polypeptides, Nat. Chem. Biol 11 (12) (2015) 909–916. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [50].Ma J, Diedrich JK, Jungreis I, et al. , Improved identification and analysis of small open reading frame encoded polypeptides, Anal. Chem 88 (7) (2016) 3967–3975. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [51].Guo B, Zhai D, Cabezas E, et al. , Humanin peptide suppresses apoptosis by interfering with Bax activation, Nature 423 (6938) (2003) 456–461. [DOI] [PubMed] [Google Scholar]
  • [52].Yaghoob Nezhad F, Verbrugge SAJ, Schonfelder M, Becker L, Hrabe de Angelis M, Wackerhage H, Genes whose gain or loss-of-function increases endurance performance in mice: a systematic literature review, Front Physiol. 10 (2019) 262. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [53].Cordero MD, Alcocer-Gomez E, Ryffel B, Gain of function mutation and inflammasome driven diseases in human and mouse models, J. Autoimmun 91 (2018) 13–22. [DOI] [PubMed] [Google Scholar]
  • [54].Grigoryan T, Wend P, Klaus A, Birchmeier W, Deciphering the function of canonical Wnt signals in development and disease: conditional loss- and gain-of-function mutations of beta-catenin in mice, Genes Dev. 22 (17) (2008) 2308–2341. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [55].Yin T, Luo J, Huang D, Li H, Current progress of mitochondrial genome editing by CRISPR, Front Physiol. 13 (2022) 883459. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [56].Jung JE, Sun G, Bautista Garrido J, et al. , The mitochondria-derived peptide humanin improves recovery from intracerebral hemorrhage: implication of mitochondria transfer and microglia phenotype change, J. Neurosci 40 (10) (2020) 2154–2165. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [57].Gruschus JM, Morris DL, Tjandra N, Evidence of natural selection in the mitochondrial-derived peptides humanin and SHLP6, Sci. Rep 13 (1) (2023) 14110. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [58].Pistolesi S, Rossini L, Ferro E, Basosi R, Trabalzini L, Pogni R, Humanin structural versatility and interaction with model cerebral cortex membranes, Biochemistry 48 (22) (2009) 5026–5033. [DOI] [PubMed] [Google Scholar]
  • [59].Yamagishi Y, Hashimoto Y, Niikura T, Nishimoto I, Identification of essential amino acids in Humanin, a neuroprotective factor against Alzheimer’s disease-relevant insults, Peptides 24 (4) (2003) 585–595. [DOI] [PubMed] [Google Scholar]
  • [60].Hashimoto Y, Niikura T, Ito Y, et al. , Detailed characterization of neuroprotection by a rescue factor humanin against various Alzheimer’s disease-relevant insults, J. Neurosci 21 (23) (2001) 9235–9245. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [61].Ying G, Iribarren P, Zhou Y, et al. , Humanin, a newly identified neuroprotective factor, uses the G protein-coupled formylpeptide receptor-like-1 as a functional receptor, J. Immunol 172 (11) (2004) 7078–7085. [DOI] [PubMed] [Google Scholar]
  • [62].Hashimoto Y, Kurita M, Aiso S, Nishimoto I, Matsuoka M, Humanin inhibits neuronal cell death by interacting with a cytokine receptor complex or complexes involving CNTF receptor alpha/WSX-1/gp130, Mol. Biol. Cell 20 (12) (2009) 2864–2873. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [63].Niikura T, Hashimoto Y, Tajima H, et al. , A tripartite motif protein TRIM11 binds and destabilizes Humanin, a neuroprotective peptide against Alzheimer’s disease-relevant insults, Eur. J. Neurosci 17 (6) (2003) 1150–1158. [DOI] [PubMed] [Google Scholar]
  • [64].Zhai D, Luciano F, Zhu X, Guo B, Satterthwait AC, Reed JC, Humanin binds and nullifies Bid activity by blocking its activation of Bax and Bak, J. Biol. Chem 280 (16) (2005) 15815–15824. [DOI] [PubMed] [Google Scholar]
  • [65].Luciano F, Zhai D, Zhu X, et al. , Cytoprotective peptide humanin binds and inhibits proapoptotic Bcl-2/Bax family protein BimEL, J. Biol. Chem 280 (16) (2005) 15825–15835. [DOI] [PubMed] [Google Scholar]
  • [66].Rossini L, Hashimoto Y, Suzuki H, et al. , VSTM2L is a novel secreted antagonist of the neuroprotective peptide Humanin, FASEB J. 25 (6) (2011) 1983–2000. [DOI] [PubMed] [Google Scholar]
  • [67].Ikonen M, Liu B, Hashimoto Y, et al. , Interaction between the Alzheimer’s survival peptide humanin and insulin-like growth factor-binding protein 3 regulates cell survival and apoptosis, Proc. Natl. Acad. Sci. USA 100 (22) (2003) 13042–13047. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [68].Yen K, Lee C, Mehta H, Cohen P, The emerging role of the mitochondrial-derived peptide humanin in stress resistance, J. Mol. Endocrinol 50 (1) (2013) R11–R19. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [69].Matsuoka M, Hashimoto Y, Humanin and the receptors for humanin, Mol. Neurobiol 41 (1) (2010) 22–28. [DOI] [PubMed] [Google Scholar]
  • [70].Niikura T, Humanin and Alzheimer’s disease: the beginning of a new field, Biochim Biophys. Acta Gen. Subj 1866 (1) (2022) 130024. [DOI] [PubMed] [Google Scholar]
  • [71].Zhu S, Hu X, Bennett S, Xu J, Mai Y, The molecular structure and role of humanin in neural and skeletal diseases, and in tissue regeneration, Front Cell Dev. Biol 10 (2022) 823354. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [72].Matsuoka M, Protective effects of Humanin and calmodulin-like skin protein in Alzheimer’s disease and broad range of abnormalities, Mol. Neurobiol 51 (3) (2015) 1232–1239. [DOI] [PubMed] [Google Scholar]
  • [73].Kigawa A, Wakui H, Maki N, et al. , Interaction of the spectrin-like repeats of alpha-actinin-4 with humanin peptide, Clin. Exp. Nephrol 8 (4) (2004) 331–338. [DOI] [PubMed] [Google Scholar]
  • [74].Maximov VV, Martynenko AV, Arman IP, Tarantul VZ, Humanin binds MPP8: mapping interaction sites of the peptide and protein, J. Pept. Sci 19 (5) (2013) 301–307. [DOI] [PubMed] [Google Scholar]
  • [75].Terashita K, Hashimoto Y, Niikura T, et al. , Two serine residues distinctly regulate the rescue function of Humanin, an inhibiting factor of Alzheimer’s disease-related neurotoxicity: functional potentiation by isomerization and dimerization, J. Neurochem 85 (6) (2003) 1521–1538. [DOI] [PubMed] [Google Scholar]
  • [76].Alsanousi N, Sugiki T, Furuita K, et al. , Solution NMR structure and inhibitory effect against amyloid-beta fibrillation of Humanin containing a d-isomerized serine residue. Biochem Biophys. Res Commun 477 (4) (2016) 647–653. [DOI] [PubMed] [Google Scholar]
  • [77].Arakawa T, Niikura T, Kita Y, The biological activity of Humanin analogs correlates with structure stabilities in solution, Int J. Biol. Macromol 49 (1) (2011) 93–97. [DOI] [PubMed] [Google Scholar]
  • [78].Oh YK, Bachar AR, Zacharias DG, et al. , Humanin preserves endothelial function and prevents atherosclerotic plaque progression in hypercholesterolemic ApoE deficient mice, Atherosclerosis 219 (1) (2011) 65–73. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [79].Stumvoll M, Goldstein BJ, van Haeften TW, Type 2 diabetes: principles of pathogenesis and therapy, Lancet 365 (9467) (2005) 1333–1346. [DOI] [PubMed] [Google Scholar]
  • [80].Grant SF, Thorleifsson G, Reynisdottir I, et al. , Variant of transcription factor 7-like 2 (TCF7L2) gene confers risk of type 2 diabetes, Nat. Genet 38 (3) (2006) 320–323. [DOI] [PubMed] [Google Scholar]
  • [81].Zeggini E, Weedon MN, Lindgren CM, et al. , Replication of genome-wide association signals in UK samples reveals risk loci for type 2 diabetes, Science 316 (5829)(2007)1336–1341. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [82].Sladek R, Rocheleau G, Rung J, et al. , A genome-wide association study identifies novel risk loci for type 2 diabetes, Nature 445 (7130) (2007) 881–885. [DOI] [PubMed] [Google Scholar]
  • [83].Kahn SE, Hull RL, Utzschneider KM, Mechanisms linking obesity to insulin resistance and type 2 diabetes, Nature 444 (7121) (2006) 840–846. [DOI] [PubMed] [Google Scholar]
  • [84].Doria A, Patti ME, Kahn CR, The emerging genetic architecture of type 2 diabetes, Cell Metab. 8 (3) (2008) 186–200. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [85].Blake R, Trounce IA, Mitochondrial dysfunction and complications associated with diabetes, Biochim Biophys. Acta 1840 (4) (2014) 1404–1412. [DOI] [PubMed] [Google Scholar]
  • [86].Rochette L, Zeller M, Cottin Y, Vergely C, Diabetes, oxidative stress and therapeutic strategies, Biochim Biophys. Acta 1840 (9) (2014) 2709–2729. [DOI] [PubMed] [Google Scholar]
  • [87].Henquin JC, Ishiyama N, Nenquin M, Ravier MA, Jonas JC, Signals and pools underlying biphasic insulin secretion, Diabetes 51 (Suppl 1) (2002) S60–S67. [DOI] [PubMed] [Google Scholar]
  • [88].Straub SG, Sharp GW, Glucose-stimulated signaling pathways in biphasic insulin secretion, Diabetes Metab. Res. Rev 18 (6) (2002) 451–463. [DOI] [PubMed] [Google Scholar]
  • [89].Kuliawat R, Klein L, Gong Z, et al. , Potent humanin analog increases glucose-stimulated insulin secretion through enhanced metabolism in the beta cell, FASEB J. 27 (12) (2013) 4890–4898. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [90].Muzumdar RH, Huffman DM, Atzmon G, et al. , Humanin: a novel central regulator of peripheral insulin action, PLoS One 4 (7) (2009) e6334. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [91].Tamas G, Kerenyi Z, Current controversies in the mechanisms and treatment of gestational diabetes, Curr. Diab Rep 2 (4) (2002) 337–346. [DOI] [PubMed] [Google Scholar]
  • [92].Mack LR, Tomich PG, Gestational diabetes: diagnosis, classification, and clinical care, Obstet. Gynecol. Clin. North Am 44 (2) (2017) 207–217. [DOI] [PubMed] [Google Scholar]
  • [93].Ma Y, Li S, Wei X, et al. , Comparison of serum concentrations of humanin in women with and without gestational diabetes mellitus, Gynecol. Endocrinol 34 (12) (2018) 1064–1067. [DOI] [PubMed] [Google Scholar]
  • [94].Conte M, Sabbatinelli J, Chiariello A, et al. , Disease-specific plasma levels of mitokines FGF21, GDF15, and Humanin in type II diabetes and Alzheimer’s disease in comparison with healthy aging, Geroscience 43 (2) (2021) 985–1001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [95].Kwon C, Sun JL, Jeong JH, Jung TW, Humanin attenuates palmitate-induced hepatic lipid accumulation and insulin resistance via AMPK-mediated suppression of the mTOR pathway, Biochem Biophys. Res. Commun 526 (2) (2020) 539–545. [DOI] [PubMed] [Google Scholar]
  • [96].Dunaif A, Insulin resistance and the polycystic ovary syndrome: mechanism and implications for pathogenesis, Endocr. Rev 18 (6) (1997) 774–800. [DOI] [PubMed] [Google Scholar]
  • [97].Wijeyaratne CN, Balen AH, Barth JH, Belchetz PE, Clinical manifestations and insulin resistance (IR) in polycystic ovary syndrome (PCOS) among South Asians and Caucasians: is there a difference? Clin. Endocrinol. (Oxf. ) 57 (3) (2002) 343–350. [DOI] [PubMed] [Google Scholar]
  • [98].Wang Y, Zeng Z, Zhao S, et al. , Humanin alleviates insulin resistance in polycystic ovary syndrome: a human and rat model-based study, Endocrinology 162 (8) (2021). [DOI] [PubMed] [Google Scholar]
  • [99].Gidlund EK, von Walden F, Venojarvi M, et al. , Humanin skeletal muscle protein levels increase after resistance training in men with impaired glucose metabolism, Physiol. Rep 4 (23) (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [100].Voigt A, Jelinek HF, Humanin: a mitochondrial signaling peptide as a biomarker for impaired fasting glucose-related oxidative stress, Physiol. Rep 4 (9) (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [101].Katsarou A, Gudbjornsdottir S, Rawshani A, et al. , Type 1 diabetes mellitus, Nat. Rev. Dis. Prim 3 (2017) 17016. [DOI] [PubMed] [Google Scholar]
  • [102].Ilonen J, Lempainen J, Veijola R, The heterogeneous pathogenesis of type 1 diabetes mellitus, Nat. Rev. Endocrinol 15 (11) (2019) 635–650. [DOI] [PubMed] [Google Scholar]
  • [103].Padgett LE, Broniowska KA, Hansen PA, Corbett JA, Tse HM, The role of reactive oxygen species and proinflammatory cytokines in type 1 diabetes pathogenesis, Ann. N. Y Acad. Sci 1281 (1) (2013) 16–35. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [104].Corbett JA, Wang JL, Sweetland MA, Lancaster JR Jr., McDaniel ML, Interleukin 1 beta induces the formation of nitric oxide by beta-cells purified from rodent islets of Langerhans. Evidence for the beta-cell as a source and site of action of nitric oxide, J. Clin. Invest 90 (6) (1992) 2384–2391. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [105].Heitmeier MR, Scarim AL, Corbett JA, Prolonged STAT1 activation is associated with interferon-gamma priming for interleukin-1-induced inducible nitric-oxide synthase expression by islets of Langerhans, J. Biol. Chem 274 (41) (1999) 29266–29273. [DOI] [PubMed] [Google Scholar]
  • [106].Chen J, Chernatynskaya AV, Li JW, et al. , T cells display mitochondria hyperpolarization in human type 1 diabetes, Sci. Rep 7 (1) (2017) 10835. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [107].O’Brien BA, Harmon BV, Cameron DP, Allan DJ, Apoptosis is the mode of beta-cell death responsible for the development of IDDM in the nonobese diabetic (NOD) mouse, Diabetes 46 (5) (1997) 750–757. [DOI] [PubMed] [Google Scholar]
  • [108].Tobiasch E, Gunther L, Bach FH, Heme oxygenase-1 protects pancreatic beta cells from apoptosis caused by various stimuli, J. Invest. Med 49 (6) (2001) 566–571. [DOI] [PubMed] [Google Scholar]
  • [109].Paraskevas S, Aikin R, Maysinger D, et al. , Activation and expression of ERK, JNK, and p38 MAP-kinases in isolated islets of Langerhans: implications for cultured islet survival, FEBS Lett. 455 (3) (1999) 203–208. [DOI] [PubMed] [Google Scholar]
  • [110].Hoang PT, Park P, Cobb LJ, et al. , The neurosurvival factor Humanin inhibits beta-cell apoptosis via signal transducer and activator of transcription 3 activation and delays and ameliorates diabetes in nonobese diabetic mice, Metabolism 59 (3) (2010) 343–349. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [111].Lytvyn Y, Wan J, Lai V, Cohen P, Cherney DZ, The effect of sex on humanin levels in healthy adults and patients with uncomplicated type 1 diabetes mellitus, Can. J. Physiol. Pharm 93 (4) (2015) 239–243. [DOI] [PubMed] [Google Scholar]
  • [112].Sonkusare SK, Kaul CL, Ramarao P, Dementia of Alzheimer’s disease and other neurodegenerative disorders-memantine, a new hope. Pharm. Res 51 (1) (2005) 1–17. [DOI] [PubMed] [Google Scholar]
  • [113].Serrano-Pozo A, Frosch MP, Masliah E, Hyman BT, Neuropathological alterations in Alzheimer disease, Cold Spring Harb. Perspect. Med 1 (1) (2011) a006189. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [114].Small SA, Duff K, Linking Abeta and tau in late-onset Alzheimer’s disease: a dual pathway hypothesis, Neuron 60 (4) (2008) 534–542. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [115].Selkoe DJ, Hardy J, The amyloid hypothesis of Alzheimer’s disease at 25 years, EMBO Mol. Med 8 (6) (2016) 595–608. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [116].Livingston G, Huntley J, Sommerlad A, et al. , Dementia prevention, intervention, and care: 2020 report of the Lancet Commission, Lancet 396 (10248) (2020) 413–446. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [117].Yiannopoulou KG, Papageorgiou SG, Current and future treatments in Alzheimer disease: an update, J. Cent. Nerv. Syst. Dis 12 (2020), 1179573520907397. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [118].Zhu Y, Lin X, Zong X, et al. , Structural basis of FPR2 in recognition of Abeta(42) and neuroprotection by humanin. Nat. Commun 13 (1) (2022) 1775. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [119].Niikura T, Sidahmed E, Hirata-Fukae C, Aisen PS, Matsuoka Y, A humanin derivative reduces amyloid beta accumulation and ameliorates memory deficit in triple transgenic mice, PLoS One 6 (1) (2011) e16259. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [120].Tajima H, Kawasumi M, Chiba T, et al. , A humanin derivative, S14G-HN, prevents amyloid-beta-induced memory impairment in mice. J. Neurosci. Res 79 (5) (2005) 714–723. [DOI] [PubMed] [Google Scholar]
  • [121].Krejcova G, Patocka J, Slaninova J, Effect of humanin analogues on experimentally induced impairment of spatial memory in rats, J. Pept. Sci 10 (10) (2004) 636–639. [DOI] [PubMed] [Google Scholar]
  • [122].Mamiya T, Ukai M, Gly(14)]-Humanin improved the learning and memory impairment induced by scopolamine in vivo, Br. J. Pharm 134 (8) (2001) 1597–1599. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [123].Fuku N, Pareja-Galeano H, Zempo H, et al. , The mitochondrial-derived peptide MOTS-c: a player in exceptional longevity? Aging Cell 14 (6) (2015) 921–923. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [124].Bratic A, Larsson NG, The role of mitochondria in aging, J. Clin. Invest 123 (3) (2013) 951–957. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [125].Wallace DC, Bioenergetic origins of complexity and disease, Cold Spring Harb. Symp. Quant. Biol 76 (2011) 1–16. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [126].Gong Z, Tas E, Muzumdar R, Humanin and age-related diseases: a new link? Front Endocrinol. (Lausanne) 5 (2014) 210. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [127].de Oliveira J, Kucharska E, Garcez ML, et al. , Inflammatory Cascade in Alzheimer’s Disease Pathogenesis: A Review of Experimental Findings, Cells 10 (10) (2021). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [128].Collaborators GBDCoD, Global, regional, and national age-sex-specific mortality for 282 causes of death in 195 countries and territories, 1980-2017: a systematic analysis for the Global Burden of Disease Study 2017, Lancet 392 (10159) (2018) 1736–1788. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [129].Yen K, Mehta HH, Kim SJ, et al. , The mitochondrial derived peptide humanin is a regulator of lifespan and healthspan, Aging (Albany N. Y) 12 (12) (2020) 11185–11199. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [130].Cai H, Liu Y, Men H, Zheng Y, Protective mechanism of humanin against oxidative stress in aging-related cardiovascular diseases, Front Endocrinol. (Lausanne) 12 (2021) 683151. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [131].Lorenzini A, Salmon AB, Lerner C, et al. , Mice producing reduced levels of insulin-like growth factor type 1 display an increase in maximum, but not mean, life span, J. Gerontol. A Biol. Sci. Med Sci 69 (4) (2014) 410–419. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [132].Yen K, Wan J, Mehta HH, et al. , Humanin prevents age-related cognitive decline in mice and is associated with improved cognitive age in humans, Sci. Rep 8 (1) (2018) 14212. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [133].Klein LE, Cui L, Gong Z, Su K, Muzumdar R, A humanin analog decreases oxidative stress and preserves mitochondrial integrity in cardiac myoblasts, Biochem Biophys. Res Commun 440 (2) (2013) 197–203. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [134].Li Y, Lin R, Peng X, et al. , The role of mitochondrial quality control in anthracycline-induced cardiotoxicity: from bench to bedside, Oxid. Med Cell Longev 2022 (2022) 3659278. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [135].Deng J, Jiang Y, Chen ZB, Rhee JW, Deng Y, Wang ZV, Mitochondrial dysfunction in cardiac arrhythmias, Cells 12 (5) (2023). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [136].Nishimoto I, Matsuoka M, niikura T, Unravelling the role of Humanin, Trends Mol. Med 10 (3) (2004) 102–105. [DOI] [PubMed] [Google Scholar]
  • [137].Matsuoka M, Hashimoto Y, Aiso S, Nishimoto I, Humanin and colivelin: neuronal-death-suppressing peptides for Alzheimer’s disease and amyotrophic lateral sclerosis, CNS Drug Rev. 12 (2) (2006) 113–122. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [138].Gottardo MF, Jaita G, Magri ML, et al. , Correction: antiapoptotic factor humanin is expressed in normal and tumoral pituitary cells and protects them from TNF-alpha-induced apoptosis, PLoS One 10 (4) (2015) e0124589. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [139].Zhao ST, Zhao L, Li JH, Neuroprotective Peptide humanin inhibits inflammatory response in astrocytes induced by lipopolysaccharide, Neurochem Res 38 (3) (2013) 581–588. [DOI] [PubMed] [Google Scholar]
  • [140].Bachar AR, Scheffer L, Schroeder AS, et al. , Humanin is expressed in human vascular walls and has a cytoprotective effect against oxidized LDL-induced oxidative stress, Cardiovasc Res 88 (2) (2010) 360–366. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [141].Kanfer G, Peterka M, Arzhanik VK, et al. , CENP-F couples cargo to growing and shortening microtubule ends, Mol. Biol. Cell 28 (18) (2017) 2400–2409. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [142].Azzarito V, Long K, Murphy NS, Wilson AJ, Inhibition of alpha-helix-mediated protein-protein interactions using designed molecules, Nat. Chem 5 (3) (2013) 161–173. [DOI] [PubMed] [Google Scholar]
  • [143].Bullock BN, Jochim AL, Arora PS, Assessing helical protein interfaces for inhibitor design, J. Am. Chem. Soc 133 (36) (2011) 14220–14223. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [144].Edwards TA, Wilson AJ, Helix-mediated protein-protein interactions as targets for intervention using foldamers. Amino Acids 41 (3) (2011) 743–754. [DOI] [PubMed] [Google Scholar]
  • [145].Mosley GA, Taupenot L, Biswas N, et al. , Biogenesis of the secretory granule: chromogranin A coiled-coil structure results in unusual physical properties and suggests a mechanism for granule core condensation, Biochemistry 46 (38) (2007) 10999–11012. [DOI] [PubMed] [Google Scholar]
  • [146].Kong BS, Min SH, Lee C, Cho YM, Mitochondrial-encoded MOTS-c prevents pancreatic islet destruction in autoimmune diabetes, Cell Rep. 36 (4) (2021) 109447. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [147].Du G, Zhang C, Wu W, et al. , Circulating MOTS-c levels are decreased in obese male children and adolescents and associated with insulin resistance, Pedia Diabetes (2018). [DOI] [PubMed] [Google Scholar]
  • [148].Cataldo LR, Fernandez-Verdejo R, Santos JL, Galgani JE, Plasma MOTS-c levels are associated with insulin sensitivity in lean but not in obese individuals, J. Invest. Med 66 (6) (2018) 1019–1022. [DOI] [PubMed] [Google Scholar]
  • [149].Yin Y, Pan Y, He J, et al. , The mitochondrial-derived peptide MOTS-c relieves hyperglycemia and insulin resistance in gestational diabetes mellitus, Pharm. Res 175 (2022) 105987. [DOI] [PubMed] [Google Scholar]
  • [150].Baylan FA, Yarar E, Relationship between the mitochondria-derived peptide MOTS-c and insulin resistance in obstructive sleep apnea, Sleep. Breath 25 (2) (2021) 861–866. [DOI] [PubMed] [Google Scholar]
  • [151].Ramanjaneya M, Bettahi I, Jerobin J, et al. , Mitochondrial-derived peptides are down regulated in diabetes subjects, Front Endocrinol. (Lausanne) 10 (2019) 331. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [152].Zempo H, Kim SJ, Fuku N, et al. , A pro-diabetogenic mtDNA polymorphism in the mitochondrial-derived peptide, MOTS-c, Aging (Albany N. Y) 13 (2) (2021) 1692–1717. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [153].Kong BS, Lee C, Cho YM, Mitochondrial-Encoded Peptide MOTS-c, Diabetes, and Aging-Related Diseases, Diabetes Metab. J 47 (3) (2023) 315–324. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [154].Yoon TK, Lee CH, Kwon O, Kim MS, Exercise, Mitohormesis, and Mitochondrial ORF of the 12S rRNA Type-C (MOTS-c), Diabetes Metab. J 46 (3) (2022) 402–413. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [155].Li Q, Lu H, Hu G, et al. , Earlier changes in mice after D-galactose treatment were improved by mitochondria derived small peptide MOTS-c, Biochem Biophys. Res. Commun 513 (2) (2019) 439–445. [DOI] [PubMed] [Google Scholar]
  • [156].Bhatti JS, Bhatti GK, Reddy PH, Mitochondrial dysfunction and oxidative stress in metabolic disorders - A step towards mitochondria based therapeutic strategies, Biochim Biophys. Acta Mol. Basis Dis 1863 (5) (2017) 1066–1077. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [157].Wu Y, Sun L, Zhuang Z, Hu X, Dong D, Mitochondrial-Derived Peptides in Diabetes and Its Complications, Front Endocrinol. (Lausanne) 12 (2021) 808120. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [158].Meikle PJ, Summers SA, Sphingolipids and phospholipids in insulin resistance and related metabolic disorders, Nat. Rev. Endocrinol 13 (2) (2017) 79–91. [DOI] [PubMed] [Google Scholar]
  • [159].Fayyaz S, Japtok L, Kleuser B, Divergent role of sphingosine 1-phosphate on insulin resistance, Cell Physiol. Biochem 34 (1) (2014) 134–147. [DOI] [PubMed] [Google Scholar]
  • [160].Laviad EL, Albee L, Pankova-Kholmyansky I, et al. , Characterization of ceramide synthase 2: tissue distribution, substrate specificity, and inhibition by sphingosine 1-phosphate, J. Biol. Chem 283 (9) (2008) 5677–5684. [DOI] [PubMed] [Google Scholar]
  • [161].Ross JS, Hu W, Rosen B, Snider AJ, Obeid LM, Cowart LA, Sphingosine kinase 1 is regulated by peroxisome proliferator-activated receptor alpha in response to free fatty acids and is essential for skeletal muscle interleukin-6 production and signaling in diet-induced obesity, J. Biol. Chem 288 (31) (2013) 22193–22206. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [162].Gueant JL, Oussalah A, Zgheib R, Siblini Y, Hsu SB, Namour F, Genetic, epigenetic and genomic mechanisms of methionine dependency of cancer and tumor-initiating cells: What could we learn from folate and methionine cycles, Biochimie 173 (2020) 123–128. [DOI] [PubMed] [Google Scholar]
  • [163].Tong X, Zhao F, Thompson CB, The molecular determinants of de novo nucleotide biosynthesis in cancer cells, Curr. Opin. Genet Dev 19 (1) (2009) 32–37. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [164].Hardie DG, AMP-activated protein kinase: an energy sensor that regulates all aspects of cell function, Genes Dev. 25 (18) (2011) 1895–1908. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [165].Steinberg GR, Kemp BE, AMPK in health and disease, Physiol. Rev 89 (3) (2009) 1025–1078. [DOI] [PubMed] [Google Scholar]
  • [166].McGee SL, van Denderen BJ, Howlett KF, et al. , AMP-activated protein kinase regulates GLUT4 transcription by phosphorylating histone deacetylase 5, Diabetes 57 (4) (2008) 860–867. [DOI] [PubMed] [Google Scholar]
  • [167].Kim KH, Son JM, Benayoun BA, Lee C, The Mitochondrial-Encoded Peptide MOTS-c Translocates to the Nucleus to Regulate Nuclear Gene Expression in Response to Metabolic Stress, Cell Metab. 28 (3) (2018) 516–524, e517. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [168].Joo MS, Kim WD, Lee KY, Kim JH, Koo JH, Kim SG, AMPK facilitates nuclear accumulation of nrf2 by phosphorylating at serine 550, Mol. Cell Biol 36 (14) (2016) 1931–1942. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [169].Hayes JD, Dinkova-Kostova AT, The Nrf2 regulatory network provides an interface between redox and intermediary metabolism, Trends Biochem Sci. 39 (4) (2014) 199–218. [DOI] [PubMed] [Google Scholar]
  • [170].D’Souza RF, Woodhead JST, Hedges CP, et al. , Increased expression of the mitochondrial derived peptide, MOTS-c, in skeletal muscle of healthy aging men is associated with myofiber composition, Aging (Albany N. Y) 12 (6) (2020) 5244–5258. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [171].Belenky P, Bogan KL, Brenner C, NAD+ metabolism in health and disease, Trends Biochem Sci. 32 (1) (2007) 12–19. [DOI] [PubMed] [Google Scholar]
  • [172].Canto G, Menzies KJ, Auwerx J, NAD(+) metabolism and the control of energy homeostasis: a balancing act between mitochondria and the nucleus, Cell Metab. 22 (1) (2015) 31–53. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [173].Garten A, Schuster S, Penke M, Gorski T, de Giorgis T, Kiess W, Physiological and pathophysiological roles of NAMPT and NAD metabolism, Nat. Rev. Endocrinol 11 (9) (2015) 535–546. [DOI] [PubMed] [Google Scholar]
  • [174].Imai S, Guarente L, NAD+ and sirtuins in aging and disease, Trends Cell Biol. 24 (8) (2014) 464–471. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [175].Haigis MC, Sinclair DA, Mammalian sirtuins: biological insights and disease relevance, Annu Rev. Pathol 5 (2010) 253–295. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [176].Verdin E, The many faces of sirtuins: coupling of NAD metabolism, sirtuins and lifespan, Nat. Med 20 (1) (2014) 25–27. [DOI] [PubMed] [Google Scholar]
  • [177].Imai S, Yoshino J, The importance of NAMPT/NAD/SIRT1 in the systemic regulation of metabolism and ageing, Diabetes Obes. Metab 15 (Suppl 3) (2013) 26–33 (0 3). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [178].Imai S, Armstrong CM, Kaeberlein M, Guarente L, Transcriptional silencing and longevity protein Sir2 is an NAD-dependent histone deacetylase, Nature 403 (6771) (2000) 795–800. [DOI] [PubMed] [Google Scholar]
  • [179].Verdin ENAD, in aging, metabolism, and neurodegeneration, Science 350 (6265) (2015) 1208–1213. [DOI] [PubMed] [Google Scholar]
  • [180].Zhu XH, Lu M, Lee BY, Ugurbil K, Chen W, In vivo NAD assay reveals the intracellular NAD contents and redox state in healthy human brain and their age dependences, Proc. Natl. Acad. Sci. USA 112 (9) (2015) 2876–2881. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [181].Mouchiroud L, Houtkooper RH, Moullan N, et al. , The NAD(+)/Sirtuin Pathway Modulates Longevity through Activation of Mitochondrial UPR and FOXO Signaling. Cell 154 (2) (2013) 430–441. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [182].Mendelsohn AR, Larrick JW, Mitochondrial-derived peptides exacerbate senescence, Rejuvenation Res. 21 (4) (2018) 369–373. [DOI] [PubMed] [Google Scholar]
  • [183].Miller RA, Buehner G, Chang Y, Harper JM, Sigler R, Smith-Wheelock M, Methionine-deficient diet extends mouse lifespan, slows immune and lens aging, alters glucose, T4, IGF-I and insulin levels, and increases hepatocyte MIF levels and stress resistance, Aging Cell 4 (3) (2005) 119–125. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [184].Zimmerman JA, Malloy V, Krajcik R, Orentreich N, Nutritional control of aging, Exp. Gerontol 38 (1-2) (2003) 47–52. [DOI] [PubMed] [Google Scholar]
  • [185].Orentreich N, Matias JR, DeFelice A, Zimmerman JA, Low methionine ingestion by rats extends life span, J. Nutr 123 (2) (1993) 269–274. [DOI] [PubMed] [Google Scholar]
  • [186].Richie JP Jr., Leutzinger Y, Parthasarathy S, Malloy V, Orentreich N, Zimmerman JA, Methionine restriction increases blood glutathione and longevity in F344 rats, FASEB J. 8 (15) (1994) 1302–1307. [DOI] [PubMed] [Google Scholar]
  • [187].Stillman CM, Esteban-Cornejo I, Brown B, Bender CM, Erickson KI, Effects of exercise on brain and cognition across age groups and health states, Trends Neurosci. 43 (7) (2020) 533–543. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [188].Gomes-Osman J, Cabral DF, Morris TP, et al. , Exercise for cognitive brain health in aging: a systematic review for an evaluation of dose, Neurol. Clin. Pr 8 (3) (2018) 257–265. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [189].Hood DA, Memme JM, Oliveira AN, Triolo M, Maintenance of skeletal muscle mitochondria in health, exercise, and aging, Annu Rev. Physiol 81 (2019) 19–41. [DOI] [PubMed] [Google Scholar]
  • [190].Ryan AS, Exercise in aging: its important role in mortality, obesity and insulin resistance, Aging Health 6 (5) (2010) 551–563. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [191].Cartee GD, Hepple RT, Bamman MM, Zierath JR, Exercise promotes healthy aging of skeletal muscle, Cell Metab. 23 (6) (2016) 1034–1047. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [192].Haaland DA, Sabljic TF, Baribeau DA, Mukovozov IM, Hart LE, Is regular exercise a friend or foe of the aging immune system? A systematic review, Clin. J. Sport Med 18 (6) (2008) 539–548. [DOI] [PubMed] [Google Scholar]
  • [193].Barnes JN, Exercise, cognitive function, and aging, Adv. Physiol. Educ 39 (2) (2015) 55–62. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [194].Crimmins EM, Lifespan and healthspan: past, present, and promise, Gerontologist 55 (6) (2015) 901–911. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [195].Reynolds JC, Lai RW, Woodhead JST, et al. , MOTS-c is an exercise-induced mitochondrial-encoded regulator of age-dependent physical decline and muscle homeostasis, Nat. Commun 12 (1) (2021) 470. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [196].Crispim D, Canani LH, Gross JL, Tschiedel B, Souto KE, Roisenberg I, The European-specific mitochondrial cluster J/T could confer an increased risk of insulin-resistance and type 2 diabetes: an analysis of the m.4216T > C and m.4917A > G variants, Ann. Hum. Genet 70 (Pt 4) (2006) 488–495. [DOI] [PubMed] [Google Scholar]
  • [197].Fuku N, Park KS, Yamada Y, et al. , Mitochondrial haplogroup N9a confers resistance against type 2 diabetes in Asians, Am. J. Hum. Genet 80 (3) (2007) 407–415. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [198].Kim SK, Tran LT, NamKoong C, et al. , Mitochondria-derived peptide SHLP2 regulates energy homeostasis through the activation of hypothalamic neurons, Nat. Commun 14 (1) (2023) 4321. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [199].Mehta HH, Xiao J, Ramirez R, et al. , Metabolomic profile of diet-induced obesity mice in response to humanin and small humanin-like peptide 2 treatment, Metabolomics 15 (6) (2019) 88. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [200].Nashine S, Cohen P, Nesburn AB, Kuppermann BD, Kenney MC, Characterizing the protective effects of SHLP2, a mitochondrial-derived peptide, in macular degeneration, Sci. Rep 8 (1) (2018) 15175. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [201].Marella M, Seo BB, Yagi T, Matsuno-Yagi A, Parkinson’s disease and mitochondrial complex I: a perspective on the Ndi1 therapy, J. Bioenerg. Biomembr 41 (6) (2009) 493–497. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [202].Kim SJ, Devgan A, Mehta HH, Cohen P, Mitochondrial-derived peptide, SHLP2, a novel protective factor in Parkinson’s disease, Innov. Aging 3 (2019) S838. [Google Scholar]
  • [203].R AA, Risk factors for Alzheimer’s disease, Folia Neuropathol. 57 (2) (2019) 87–105. [DOI] [PubMed] [Google Scholar]
  • [204].Xiao J, Howard L, Wan J, et al. , Low circulating levels of the mitochondrial-peptide hormone SHLP2: novel biomarker for prostate cancer risk, Oncotarget 8 (55) (2017) 94900–94909. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [205].Woodhead JST, D’Souza RF, Hedges CP, et al. , High-intensity interval exercise increases humanin, a mitochondrial encoded peptide, in the plasma and muscle of men, J. Appl. Physiol. (1985) 128 (5) (2020) 1346–1354. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [206].Miller B, Kim SJ, Mehta HH, et al. , Mitochondrial DNA variation in Alzheimer’s disease reveals a unique microprotein called SHMOOSE, Mol. Psychiatry 28 (4) (2023) 1813–1826. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [207].Kienzle L, Bettinazzi S, Choquette T, et al. , A small protein coded within the mitochondrial canonical gene nd4 regulates mitochondrial bioenergetics, BMC Biol. 21 (1) (2023) 111. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [208].Spinelli JB, Haigis MC, The multifaceted contributions of mitochondria to cellular metabolism, Nat. Cell Biol 20 (7) (2018) 745–754. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [209].Mottis A, Herzig S, Auwerx J, Mitocellular communication: Shaping health and disease, Science 366 (6467) (2019) 827–832. [DOI] [PubMed] [Google Scholar]
  • [210].Kelley DE, He J, Menshikova EV, Ritov VB, Dysfunction of mitochondria in human skeletal muscle in type 2 diabetes, Diabetes 51 (10) (2002) 2944–2950. [DOI] [PubMed] [Google Scholar]
  • [211].Ritov VB, Menshikova EV, He J, Ferrell RE, Goodpaster BH, Kelley DE, Deficiency of subsarcolemmal mitochondria in obesity and type 2 diabetes, Diabetes 54 (1) (2005) 8–14. [DOI] [PubMed] [Google Scholar]
  • [212].Patti ME, Butte AJ, Crunkhorn S, et al. , Coordinated reduction of genes of oxidative metabolism in humans with insulin resistance and diabetes: Potential role of PGC1 and NRF1, Proc. Natl. Acad. Sci. USA 100 (14) (2003) 8466–8471. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [213].Mootha VK, Lindgren CM, Eriksson KF, et al. , PGC-1alpha-responsive genes involved in oxidative phosphorylation are coordinately downregulated in human diabetes, Nat. Genet 34 (3) (2003) 267–273. [DOI] [PubMed] [Google Scholar]
  • [214].Reynolds JC, Bwiza CP, Lee C, Mitonuclear genomics and aging, Hum. Genet 139 (3) (2020) 381–399. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [215].Kim SJ, Miller B, Kumagai H, Silverstein AR, Flores M, Yen K, Mitochondrial-derived peptides in aging and age-related diseases, Geroscience 43 (3) (2021) 1113–1121. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [216].Mahata SK, O’Connor DT, Mahata M, et al. , Novel autocrine feedback control of catecholamine release. A discrete chromogranin A fragment is a noncompetitive nicotinic cholinergic antagonist, J. Clin. Invest 100 (6) (1997) 1623–1633. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [217].Mahata SK, Mahata M, Wakade AR, O’Connor DT, Primary structure and function of the catecholamine release inhibitory peptide catestatin (chromogranin A344-364): Identification of amino acid residues crucial for activity, Mol. Endocrinol 14 (10) (2000) 1525–1535. [DOI] [PubMed] [Google Scholar]
  • [218].Jati S, Mahata S, Das S, Chatterjee S, Mahata SK, Catestatin: Antimicrobial Functions and Potential Therapeutics, Pharmaceutics 15 (5) (2023). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [219].Boutari C, Pappas PD, Theodoridis TD, Vavilis D, Humanin and diabetes mellitus: A review of in vitro and in vivo studies, World J. Diabetes 13 (3) (2022) 213–223. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [220].Gayen JR, Zhang K, Ramachandrarao SP, et al. , Role of reactive oxygen species in hyperadrenergic hypertension: Biochemical, physiological, and pharmacological evidence from targeted ablation of the chromogranin A gene, Circ. Cardiovasc Genet 3 (2010) 414–425. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [221].Thummasorn S, Shinlapawittayatorn K, Khamseekaew J, Jaiwongkam T, Chattipakorn SC, Chattipakorn N, Humanin directly protects cardiac mitochondria against dysfunction initiated by oxidative stress by decreasing complex I activity, Mitochondrion 38 (2018) 31–40. [DOI] [PubMed] [Google Scholar]
  • [222].Lee C, Kim KH, Cohen P, MOTS-c: A novel mitochondrial-derived peptide regulating muscle and fat metabolism, Free Radic. Biol. Med 100 (2016) 182–187. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [223].Bulut F, Adam M, Ozgen A, et al. , Protective effects of chronic humanin treatment in mice with diabetic encephalopathy: a focus on oxidative stress, inflammation, and apoptosis, Behav. Brain Res 452 (2023) 114584. [DOI] [PubMed] [Google Scholar]
  • [224].Li H, Ren K, Jiang T, Zhao GJ, MOTS-c attenuates endothelial dysfunction via suppressing the MAPK/NF-kappaB pathway. Int J. Cardiol 268 (2018) 40. [DOI] [PubMed] [Google Scholar]
  • [225].Penna C, Pasqua T, Amelio D, et al. , Catestatin increases the expression of anti-apoptotic and pro-angiogenetic factors in the post-ischemic hypertrophied heart of SHR, PLoS One 9 (8) (2014) e102536. [DOI] [PMC free article] [PubMed] [Google Scholar] [Retracted]
  • [226].Sharp TE 3rd, Gong Z, Scarborough A, et al. , Efficacy of a novel mitochondrial-derived peptide in a porcine model of myocardial ischemia/reperfusion injury, JACC Basic Transl. Sci 5 (7) (2020) 699–714. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [227].Mahata SK, Kiranmayi M, Mahapatra NR, Catestatin: a master regulator of cardiovascular functions, Curr. Med Chem 25 (11) (2018) 1352–1374. [DOI] [PubMed] [Google Scholar]
  • [228].Angelone T, Quintieri AM, Brar BK, et al. , The antihypertensive chromogranin a peptide catestatin acts as a novel endocrine/paracrine modulator of cardiac inotropism and lusitropism, Endocrinology 149 (10) (2008) 4780–4793. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [229].Penna C, Alloatti G, Gallo MP, et al. , Catestatin improves post-ischemic left ventricular function and decreases ischemia/reperfusion injury in heart, Cell Mol. Neurobiol 30 (8) (2010) 1171–1179. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [230].Dabravolski SA, Nikiforov NG, Starodubova AV, Popkova TV, Orekhov AN, The role of mitochondria-derived peptides in cardiovascular diseases and their potential as therapeutic targets, Int J. Mol. Sci 22 (16) (2021). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [231].Yang Y, Gao H, Zhou H, et al. , The role of mitochondria-derived peptides in cardiovascular disease: recent updates, Biomed. Pharm 117 (2019) 109075. [DOI] [PubMed] [Google Scholar]
  • [232].Avolio E, Mahata SK, Mantuano E, et al. , Antihypertensive and neuroprotective effects of catestatin in spontaneously hypertensive rats: interaction with GABAergic transmission in amygdala and brainstem, Neuroscience 270 (2014) 48–57. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Data Availability Statement

No data was used for the research described in the article.

RESOURCES