Table 1. Sequences and structures of eleven antagonists.
| CXCR4 antagonists | Sequence*/structure | IC50 (nM) |
|---|---|---|
| HC4319 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro-Lys | 46.0 ± 12.6 |
| Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys | ||
| DV1 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro | 364.7 ± 51.7 |
| DV3 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys | 2596.6 ± 422.4 |
| DV1 dimer | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro | 60.5 ± 12.8 |
| Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro | ||
| V1 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro | 2632.1 ± 891.0 |
| vMIP-II | LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR | 10† |
| CVX15 |
|
7.8 ± 2.2 |
| LY2510924 | Cyclo[Phe-Tyr-Lys(iPr)-D-Arg-2-Nal-Gly-D-Glu]-Lys(iPr)-NH2 | 135.4 ± 63.9 |
| IT1t |
|
29.65 ± 2.8 |
| AMD3100 |
|
319.6 ± 37.3 |
| AMD11070 |
|
15.6 ± 7.6 |
| HM60303 | Lys-Arg-Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys | >50,000 |
| HM60323 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Arg | 706.6 ± 143.2 |
| HM12 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Arg-Arg | 544.0 ± 75.0 |
| HM13 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys-Nal-Arg-Arg | 377.4 ± 7.7 |
| HM70116 | Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Nal-Arg-Arg | 193.9 ± 37.9 |
Sequences of the D-peptides HC4319, DV1, DV1 dimer, DV3, HM60303, HM60323, HM12, HM13, and HM70116 are composed of D-amino acids. The sequence of vMIP-II is shown by one letter code.
The IC50 value of vMIP-II was from the previously published results [42]. The IC50 values of CXCR4 antagonists were averages of at least three independent experiments shown as mean ± standard error of mean (S.E.M.).