Fig. 1.

Partial three-dimensional structure of the lentiviral EIAV nucleocapsid protein NCp11. The three-dimensional structure of a peptide of 37 amino acids (QTCYNCGKPGHLSSQCRAPKVCFKCKQPGHFSKQCRS) corresponding to residues 22–58 from the lentiviral EIAV nucleocapsid protein NCp11 (Protein Data Bank identification code for the partial structure: 2BL6) is shown. This peptide contains two ZCCHCs of the CX₂CX₃GHX₄C type, which are underlined in the sequence above, and is complexed with zinc (red spheres). Only the relevant C and H residues of the ZCCHCs are highlighted. The structure shown in this figure was determined by two-dimensional hydrogen isotope nuclear magnetic resonance spectroscopy, as previously described [10]. We obtained this image using the Visual Molecular Dynamics molecular visualization program (https://www.ks.uiuc.edu/Research/vmd/) [11]