Table 3.
SV-derived peptides with immunosuppressive activities
| Peptide/venom | Sequence | Species | Dose | Immunosuppressive activities | Reference |
|---|---|---|---|---|---|
| Osk-1 (4.22 KDa) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | Orthochirus scrobiculosus | Kv1.1: 0.6 nM Kv1.2: 5.4 nM KCa3.1: 225 nM | Inhibits KV1.3 more than KV1.1, and KV1.2 channels | (Gubič et al. 2021) |
| Margatoxin (MgTx) | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | Centruroides margartatus | 1 nM | Blocks KV1.3 channels | (Feske et al. 2015) |
| St-20 (α-KTx) | TKCSGSPECVKFCRNGKCMNRSCKCYLCS | Scorpions tibetanushas | (0, 1, 10, 100 nM) | Decreases CD69 expression and the release interleukin-2 IL-2, tumor necrosis factor (TNF-α), and IFN-γ in activated human T cells | (Padmanabhan and Prince 2006) |
| ImKTx-88 | QIYTSKECNGSSECYSHCEGITGKRSGKCINKKCVCYR | Isometrus masculatus (Im) | 100 nM, 1, and 10 μM | Specifically inhibits KV1.3 channels | (Huang et al. 2017) |
| Bmk -AGAP | VRDGYIADDKNCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKLPDKVPIRVPGKCNGG | Buthus martensi Karsch (Chinese scorpion) | 0, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, and 60 µM | Specially binds to Nav 1.5 channels | (Kampo et al. 2019) |
| Bmk fraction (SVCIII) (70–80 KDa) | CGPCFTTDANMARKCRECCGGIGKCFGPQCLCNRI | 0, 1, 5, 10, 20, 30, 40 and 50 µg/ml | Inhibits NF-κB activation through inhibition of IκBα phosphorylation, degradation, and p65 nuclear translocation | (Song et al. 2012) | |
| Ts-6 | WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT | T. serrulatus | 50, 250, 1250 nM | Both inhibit the function and proliferation of several T-cell subgroups in vitro by blocking KV2 channels | (Pucca et al. 2016) |
| Ts-15 | GKFGKCKPNICAKTCQTEKGKGMGYCNKTECVCSEW |