Skip to main content
. 2024 Oct 3;11(1):93. doi: 10.1186/s40643-024-00805-0

Table 3.

SV-derived peptides with immunosuppressive activities

Peptide/venom Sequence Species Dose Immunosuppressive activities Reference
Osk-1 (4.22 KDa) GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK Orthochirus scrobiculosus Kv1.1: 0.6 nM Kv1.2: 5.4 nM KCa3.1: 225 nM Inhibits KV1.3 more than KV1.1, and KV1.2 channels (Gubič et al. 2021)
Margatoxin (MgTx) TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH Centruroides margartatus 1 nM Blocks KV1.3 channels (Feske et al. 2015)
St-20 (α-KTx) TKCSGSPECVKFCRNGKCMNRSCKCYLCS Scorpions tibetanushas (0, 1, 10, 100 nM) Decreases CD69 expression and the release interleukin-2 IL-2, tumor necrosis factor (TNF-α), and IFN-γ in activated human T cells (Padmanabhan  and Prince 2006)
ImKTx-88 QIYTSKECNGSSECYSHCEGITGKRSGKCINKKCVCYR Isometrus masculatus (Im) 100 nM, 1, and 10 μM Specifically inhibits KV1.3 channels (Huang et al. 2017)
Bmk -AGAP VRDGYIADDKNCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKLPDKVPIRVPGKCNGG Buthus martensi Karsch (Chinese scorpion) 0, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, and 60 µM Specially binds to Nav 1.5 channels (Kampo et al. 2019)
Bmk fraction (SVCIII) (70–80 KDa) CGPCFTTDANMARKCRECCGGIGKCFGPQCLCNRI 0, 1, 5, 10, 20, 30, 40 and 50 µg/ml Inhibits NF-κB activation through inhibition of IκBα phosphorylation, degradation, and p65 nuclear translocation (Song et al. 2012)
Ts-6 WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT T. serrulatus 50, 250, 1250 nM Both inhibit the function and proliferation of several T-cell subgroups in vitro by blocking KV2 channels (Pucca et al. 2016)
Ts-15 GKFGKCKPNICAKTCQTEKGKGMGYCNKTECVCSEW