Table 5.

In vivo anti-cancer effect of SV and SVPs and their mechanisms of action

Peptide/venom	Sequence	Dosage	Duration	Species origin	Activity	Mechanism	Reference
Crude venom	–	0.22 mg/kg/day i.p. (20% LD dose)	13 days	A amoreuxi	Decreasing Ehrlich ascites carcinoma and solid Ehrlich tumor size, but mice-bearing intraperitoneal tumor survival increasing	Down-regulates Ki-67 and VEGF expression and up-regulates Caspase-3 expression	(Salem et al. 2016)
Bmk -AGAP 71.42KDa with 66 amino acids	VRDGYIADDKNCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKLPDKVPIRVPGKCNGG	(0.5 and 1 mg/kg) injected i.p	20 days at 48 h. intervals	B martensii	Reduced tumor growth of MDA-MB-231 cells in mice	Reduces gene and protein expression in ex vivo tumors of Oct4, SOX2, Nanog, N-cadherin, Snail, and PTX3, and increases the expression of E-cadherin	(Kampo et al. 2019)
Crude venom	–	17.5, 35, 52.5 µg	twice a week for 16 weeks	L quinquestriatus	Decreased skin carcinogenesis incidence in mice	Downregulates expression of Ki-67, NF-kB, Cox-2, Bcl-2, VEGF, and pro-inflammatory cytokines (TNF-α and IL-6)	(Almaaytah et al., 2016)
TAM-601 (synthetic ClTx) TAM-601	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR	2. 10, or 100 mg/kg (i.v.)	3x/week for 2 weeks	L quinquestriatus	Blocks angiogenesis in chick. Chorioallantoic membrane growing human tumors. Reduces micro-vessel count in mice using Matrigel plug assay	Inhibits VEGF, PDF, and TNF-α action on vascularization and blocks MMP-2 activity	(Jacoby et al. 2010)
Gonearrestide 18 amino acids (P13) (2192 Da)	W C Y K L P D R V S I K E K G R C N	50 and 100 µM peritumoral injection	2 weeks	A mauritanicus	prevents tumor growth in HCT116 (colon cancer cell line) in dose-dependent	Cell cycle checkpoint proteins modulation (down-regulates CDK4, and up-regulates cyclin D3, p21, p27)	(Li, B. et al., 2018)