Skip to main content
. 2025 Apr 2;16:3162. doi: 10.1038/s41467-025-58383-4

Table 1.

Tau epitopes (identified by NMR) recognized by the anti-tau VHHs and kon, koff, and KD (affinity parameters) measured for each VHH and full-length tau2N4R or tau1N4R

VHH tau epitope kon (M1.s1)*10+2 koff (s1)*10-3 KD (nM)
2N4R 1N4R 2N4R 1N4R 2N4R 1N4R
B1-1 224KKVAVVR230 379 ± 25 608 ± 18 10.9 ± 0.66 27.9 ± 0.40 289 ± 26 460 ± 15
C3-2 243LQTAPVPMPDLKNVKSKI260 29 ± 0.2 29 ± 0.5 2.8 ± 0.02 2.5 ± 0.04 979 ± 12 857 ± 20
A31 275VQIINKKLDLSN286 3524 ± 26 3311 ± 24 12.3 ± 0.06 12.1 ± 0.06 35 ± 0.1 37 ± 0.1
Z70mut1 305SVQIVYKP312 1517 ± 30 1523 ± 30 65.8 ± 0.62 71.4 ± 0.65 434 ± 9 468 ± 10
A5-2 339VKSEKLDFKDRVQSKIGSLDNITHVPGGGNKK370 977 ± 41 618 ± 25 56.2 ± 1.15 32.4 ± 0.62 576 ± 27 525 ± 24
F8-2 369KIETHKLTFREN381 531 ± 11 575 ± 11 40 ± 0.40 42.5 ± 0.39 753 ± 17 740 ± 16
E2-2 449 ± 3 467 ± 3 3.8 ± 0.03 4.5 ± 0.04 84 ± 1 96 ± 1
H3-2 6298 ± 31 5544 ± 25 5.6 ± 0.03 6.0 ± 0.03 8.9 ± 0.1 11 ± 0.1