Abstract
The growing threat of antimicrobial resistance has intensified the search for alternative strategies to conventional antibiotics and preservatives. Casein-derived antimicrobial peptides (CDAMPs), generated through proteolysis, exhibit potent activity against a broad spectrum of pathogens, including antibiotic-resistant strains, revealing strong potential as natural preservatives and therapeutic agents in food and medical applications. Furthermore, casein can be an ideal source for peptide production in these sectors due to its abundance, disordered structure, which enhances enzymatic cleavage, and its amino acid profile, which favors bioactivity. Nonetheless, there is limited literature addressing real-life applications in veterinary medicine, food safety, and public health. This review provides a structured synthesis of current knowledge on the antibacterial properties of CDPs. We classify the main types of these peptides, describe their production methods, and summarize their mechanisms of action against Gram-positive and Gram-negative bacteria. Furthermore, we examine their potential applications in clinical, veterinary, and food-related contexts, and discuss key aspects related to delivery systems, safety, and regulatory considerations. Overall, our findings highlight the potential of CDPs in addressing antimicrobial resistance, reducing antibiotic use in livestock and humans, and contributing to sustainable food safety and functional food production.
Keywords: milk, casein, casein-derived peptides, antibacterial activity, food bioactives, functional foods, clinical applications
1. Introduction
Caseins are the predominant proteins in milk and have long been valued for their nutritional and functional properties. Etymologically derived from the Latin word caseus (cheese), the term casein reflects its historical use in cheese production [1]. While dairy products rich in casein have long been associated with therapeutic benefits, including enhanced satiety, improved nutritional value, and muscle maintenance [2,3,4,5], caseins and their derivatives have gained considerable attention in the food industry as stabilizers and carriers in complex formulations such as emulsions, foams, and nanoparticles [6,7]. Nonetheless, one of the most notable and promising characteristics of caseins and their derivatives is their ability to release bioactive peptides through enzymatic hydrolysis, microbial fermentation, or gastrointestinal digestion [2,8,9,10]. These encrypted peptides, which are inactive within the native protein structure, can exert a wide range of physiological effects once liberated and absorbed. Documented bioactivities include antihypertensive, immunomodulatory, antioxidant, and antimicrobial effects [9]. Among these, antimicrobial activity has gained increasing attention due to its potential in addressing the global antimicrobial resistance (AMR) crisis [11,12]. An expanding body of evidence demonstrates that specific casein-derived peptides (CDPs) inhibit various pathogenic bacteria via diverse mechanisms that may bypass conventional resistance pathways [13,14]. Due to their natural origin, biocompatibility, and low toxicity, their application can be safely extended to functional foods, nutraceuticals, and veterinary products [10], with potential relevance for human and animal health, food preservation, and clinical nutrition [15,16]. Being the most abundant milk proteins, caseins offer a sustainable and accessible source for peptide production and are particularly well suited for the generation of bioactive peptides due to their intrinsic structural characteristics. On the one hand, unlike globular proteins, caseins are classified as intrinsically disordered proteins (IDPs), which lack a rigid tertiary structure. This structural disorder enhances their susceptibility to enzymatic cleavage during digestion, fermentation, or processing, facilitating the release of functional peptides [17]. Furthermore, caseins form micellar structures—colloidal aggregates that improve solubility and allow slow, sustained release of peptides under physiological conditions [18,19]. These micelles contribute to prolonged peptide bioavailability, which is particularly advantageous for therapeutic and functional food applications. Additionally, caseins are enriched in hydrophobic and cationic amino acids such as lysine, arginine, and proline—residues commonly found in antimicrobial peptides, which confer amphipathic properties that allow interaction with bacterial membranes and may also play roles in mineral binding [20,21,22,23].
Nevertheless, not unlike for other milk-derived peptides, a clear gap remains in the translation of CDPs into applied contexts. There is limited literature addressing aspects such as delivery systems, regulatory classification, or real-life applications in veterinary medicine, food safety, or public health. This work aims not only to consolidate existing knowledge on the antimicrobial properties of CDPs, but also to assess their practical relevance, implementation strategies, and potential for integration into clinical, veterinary, and food systems. By bridging basic and applied research, this review aims to inform the development of effective, safe, and sustainable antimicrobial strategies based on casein bioactive peptides.
This review includes studies involving caseins and casein-derived peptides from bovine, ovine, and caprine milk. However, due to the heterogeneity of sources in the literature and the general focus of this review on casein structure and bioactivity, the specific animal origin of each protein or peptide is not systematically identified throughout the text. Where the source species was explicitly stated in the original study and relevant to the interpretation, it is mentioned. Nonetheless, the overall discussion emphasizes general casein characteristics and functionalities, regardless of species-specific variation.
2. Caseins’ Structure
Milk consists primarily of water (85–87%), fats (3.8–5.5%), proteins (2.9–3.5%), and carbohydrates (5%) at the macroscopic level [24]. At the microscopic level, it contains vitamins, minerals, organic acids, biogenic amines, nucleotides, immunoglobulins, and oligosaccharides [24,25]. Of the total protein content, approximately 80% is casein, with the remaining 20% being whey proteins [8,22].
Caseins are encoded by single autosomal genes [1]. The major casein proteins include αS1-casein (CSN1S1), αS2-casein (CSN1S2), β-casein (CSN2), and κ-casein (CSN3), which represent approximately 40%, 12.5%, 35%, and 12.5% of the total casein fraction, respectively [1,22]. Comparative genomic studies across species, including cows, humans, camels, and elephants, show that CSN1S1 and CSN2 are closely related, while CSN3 is the most divergent, with CSN1S2 occupying an intermediate position [1]. Genetic polymorphisms lead to significant heterogeneity among casein proteins, producing various protein variants. These variations arise from point mutations, peptide fragment deletions, and post-translational modifications such as glycosylation, phosphorylation, or partial hydrolysis [22].
Structurally, caseins exhibit low homology in their primary sequence due to extensive genetic variability. Their secondary structure is characterized by a paucity of α-helices and β-sheets, conferring flexibility and a random coil conformation. This plasticity enables intermolecular electrostatic, hydrogen, and hydrophobic interactions. The tertiary structure is poorly defined, while the quaternary structure consists of micellar aggregates [20,22].
2.1. Casein Micelles
Caseins form micelles, colloidal aggregates that are essential for the stability and bioavailability of milk proteins. These micelles consist of approximately 95% protein and 5% minerals, primarily calcium phosphate (MCP), which is composed of calcium, phosphate, magnesium, and citrate [26,27]. The structure of casein micelles is not fully understood, but they are described as nearly spherical with a radius of 50–150 nm [1].
The κ-casein molecules are predominantly located on the surface of the micelles, stabilizing the structure through electrostatic repulsion and steric hindrance. This stabilization is influenced by the length and density of the κ-casein glycoprotein brushes. When the κ-casein brushes collapse, as in acidification or ethanol treatments, casein molecules aggregate, leading to gel formation [27].
2.2. Functional Properties
Caseins exhibit advantageous nutritional and technological properties, attributed to their stability under processing conditions, protection against oxidative damage, and high bioavailability. Functionally, they play a central role in milk coagulation, a fundamental step in cheese production. Coagulation, whether induced by acid or rennet, initiates upon the neutralization of the negative charges on κ-casein, ultimately leading to casein precipitation and gel formation [1]. Beyond this, caseins possess molecular chaperone activity, acting to stabilize other proteins under thermal or physiological stress by preventing their aggregation and denaturation—an attribute of particular relevance during processes such as milk pasteurization [1].
Among the casein fractions, αS1-casein is the most abundant, with a molecular mass of 23.6 kDa and comprising 199 amino acids, 8.4% of which are proline residues [22,27]. Four genetic variants (A, B, C, and D) are described, with variant B being the most prevalent. Structurally, αS1-casein is characterized by a disordered conformation, with a limited presence of α-helices and β-sheets [17,28]. Similarly, αS2-caseins possess a molecular weight ranging from 25.2 to 25.4 kDa, composed of 207 amino acids, and share comparable secondary structural features [22,27].
Both αS1- and αS2-caseins have been shown to exert chaperone-like activity [6,22]. This property is typically evaluated in vitro by subjecting a target protein to defined stress conditions (e.g., thermal, oxidative, or reductive), in the presence of varying concentrations of the putative chaperone [6]. In the milk matrix, αS1-caseins are critical for the stabilization of other proteins, such as β-casein and β-lactoglobulin, preventing their denaturation and aggregation [22]. The chaperone activity of αS1- and αS2-caseins has been reported to resemble that of small heat shock proteins (sHsps) and clusterin. sHsps, with molecular weights in the range 15–30 kDa, differ from classical heat shock proteins in that they do not require ATP for function. They bind to misfolded or stressed proteins, stabilizing them through the formation of large molecular complexes that hinder aggregation [6].
β-casein, with a molecular weight of approximately 24 kDa and 209 amino acids [22,27], contains secondary structural motifs such as β-sheets and β-turns and is considered the most hydrophobic of all caseins. To date, 12 genetic variants of β-casein have been identified (A1, A2, A3, B, C, D, E, F, G, H1, H2, and I) [22,27,29], with particular attention given to variants A1 and A2 due to their potential nutritional and technological implications [30,31]. As an amphiphilic protein, β-casein has the ability to self-assemble into micellar structures under physiological or acidic conditions, orienting its hydrophobic domains toward the micellar core while exposing hydrophilic regions to the external environment [22]. Moreover, β-casein displays a reversible tendency to dissociate from micelles at low temperatures, a property that significantly affects micellar integrity during cold storage or isolation procedures [32,33].
κ-casein, distinct from α- and β-caseins, is a glycoprotein composed of 169 amino acids and a molecular mass of approximately 19 kDa. Its various isoforms differ in their degree of glycosylation, contributing to functional diversity in milk. To date, 11 genetic variants of κ-casein have been described [22,27].
3. Bioactive Peptides Derived from Caseins
Beyond their well-recognized nutritional role, caseins constitute a reservoir of encrypted bioactive peptides with significant biological potential [1,27]. These casein-derived peptides (CDPs) have garnered increasing scientific interest due to their wide spectrum of bioactivities, which may confer beneficial effects on both human and animal health [10]. Numerous physiological functions have been attributed to these peptides, including antimicrobial, antihypertensive, opioid-like, and immunomodulatory actions [34]. The diversity of these biological effects arises from specific amino acid sequences within the parent casein proteins that, upon enzymatic release, can interact with distinct molecular targets in the organism [35]. Figure 1 illustrates the principal bioactivities and potential applications associated with bioactive peptides derived from casein.
Figure 1.
Different possible applications for casein-derived bioactive peptides. Adapted from [36,37].
In terms of cardiovascular health, some CDPs, like casokinins, exhibit angiotensin-converting enzyme (ACE)-inhibitory effects, which help regulate blood pressure [38]. This mechanism is similar to certain antihypertensive drugs but offers a natural, food-based intervention. With lifestyle-related hypertension on the rise, CDPs offer a potential dietary approach to managing blood pressure. Additionally, CDPs such as β-casomorphins interact with opioid receptors, resulting in mild analgesic and calming effects [39]. These effects may be beneficial for stress management, while the peptides’ ability to modulate immune responses and exert anti-inflammatory effects could play a role in managing immune-related diseases [38,40]. Some of the most known are described in Table 1. This broad range of effects underscores the importance of CDPs in the development of functional foods targeting mental wellness and immune support.
Table 1.
Examples of CDPs: structures, bioactivities, and applications.
| Category | Peptide Name | Sequence | Bioactivity | Concentration | Applications | References |
|---|---|---|---|---|---|---|
| 1. Casomorphins | β-Casomorphin-5; β-Casomorphin-7 |
YPFPGPIPNSL; YPFPGPI |
Opioid, ACE-inhibitory, immunomodulatory (µM) |
10.00 | Potential influence on immune and neurological systems; excessive intake may lead to gastrointestinal discomfort or altered immune responses. | [41,42] |
| 2. Casokinins | Casokinin-10 | YQQPVLGPVR | ACE-inhibitory (µM) |
300.00 | Potential applications in functional foods to manage hypertension, as a natural alternative to ACE inhibitors. | [43,44] |
| 3. Lactoferricin-Like Peptides | Lactoferricin-like peptides derived from β-casein | FKCRRWQWRMKKLGAPSITCVRRAF | Antimicrobial (MIC) mg/mL |
B. cereus—400; B. subtilis—6.3; L. innocua—6.3; L. monocytogenes—6.3; E. coli—12,5; S. entiritidis—25; S. thyphimurium—6.3 |
Natural antimicrobials for food safety and potential therapeutic agents in animal health. | [45,46] |
| 4. αs1-Casein Hexapeptide | α-casozepine | YLGYLEQLLR | Anxiolytic | Used in stress relief products, studied for calming effects on stress-related behaviors. | [47,48] |
3.1. Production of CDPs
There are multiple methods for the production of casein-derived antimicrobial peptides [36,49] (Figure 2), although certain requirements must be met by the peptide, namely minimizing undesirable side effects in the organism and exhibiting minimal immunoreactivity [37,50].
The main methodologies include enzymatic production and microbial fermentation [10,16,51], although there are several other emerging methods [52].
Figure 2.
Main production methods to obtain bioactive peptides adapted from [10,15,51,53].
The most common strategies for producing milk-derived peptides are microbial proteolytic activity, extracellular proteases, food-grade enzymes, and the application of recombinant DNA technology [23], with the fermentation route by LAB being the most common [8]. Enzymatic hydrolysis, widely used in the food and pharmaceutical industries [54], offers advantages, including the ability to scale production with reduced reaction times and less residual solvent presence [10,16]. In vivo digestive enzymes such as pepsin, trypsin, and chymotrypsin are responsible for protein hydrolysis [55]. In vitro models simulate gastrointestinal digestion via proteolytic enzymes, including alcalase and thermolysin, in combination with pepsin and trypsin. Microbial fermentation, using lactic acid bacteria (LAB), has the advantage of lower costs, as microorganisms are less expensive than commercial enzymes [54]. This fermentation primarily uses bacteria or yeasts to hydrolyze proteins during their growth, with temperature and pH being a critical parameter in this method [10]. Starter cultures, composed of LAB consortia, ensure better control and consistency in the organoleptic characteristics of the final products [51,56], including Lactococcus lactis, Lactobacillus helveticus, and Lactobacillus delbrueckii ssp. bulgaricus. These cultures optimize and ensure greater control over fermentation processes used to obtain peptides with consistent organoleptic characteristics [51,56]. LAB are widely used in the food industry, particularly in the production of yogurt and cheese [57], and perform either homofermentative or heterofermentative fermentations, with the main difference being the byproducts generated, such as lactic acid, and in the case of heterofermentation, acetic acid, carbon dioxide, and ethanol [58]. One of the main advantages of using microorganisms for peptide production is that the lactic acid produced can acidify the medium and inhibit the growth of undesirable microorganisms [56,59]. Finally, the combination of proteolysis with high hydrostatic pressures has the benefit of increasing enzymatic activity without the need for prior thermal treatments, which reduces production costs and limits microbial growth, benefiting both the food and pharmaceutical industries [52].
Additionally, novel technologies have emerged to enhance the efficiency of bioactive peptide production, such as high hydrostatic pressure, ultrasonography, microwave-assisted extraction, ohmic heating, pulsed electric fields, and subcritical water hydrolysis [10,15,51,52,53,60]. Currently, these advanced technologies are often integrated with enzymatic hydrolysis or microbial fermentation to reduce production costs while enhancing peptide yield, bioactivity, and efficiency [61,62]. Peptidomics has also become an essential tool in dairy research, extending beyond the study of protein digestion. In the dairy industry, these tools are employed to identify peptides in various dairy products, such as kefir [63], yogurt [64], and cheeses [65,66,67,68] and can be used to isolate and track these targeted peptides throughout complex proteolytic processes [69].
3.2. Antibacterial Activities of CDPs
Overall, antibacterial activities in casein and its derived peptides have received significant attention due to their broad-spectrum antimicrobial properties and their potential application in food safety and health. So far, several dozens of antimicrobial peptides (AMPs) derived from milk have been extensively characterized. While some were named [8,70], numerous other bioactive sequences have been identified but remain unnamed. Overall, CDPs originate from different casein fractions, including α-S1-, α-S2-, β-, and κ-caseins while, for example, casecidin A and B are derived from α-casein, lactenin and isracidin from β-casein, and kappacin from κ-casein [70], to name a few of the most referenced. Most milk-derived peptides possess low molecular weights, generally below 10 kDa, which facilitates rapid interaction with microbial targets and may enhance their antimicrobial efficacy compared to peptides from other food sources [71], demonstrating both bacteriostatic and bactericidal activity against a wide range of pathogens, including antibiotic-resistant strains [70,72]. For example, CAMP211-225, identified in 2020, exhibits significant antibacterial activity against Escherichia coli and Yersinia enterocolitica [73]. This peptide was found in higher concentrations in preterm human milk and displayed minimum inhibitory concentrations (MICs) of 3.125 μg/mL and 6.25 μg/mL, respectively, against E. coli and Y. enterocolitica, acting mostly thought membrane disruption, contributing to rapid bacterial cell death [74].
To consolidate this growing body of knowledge, several online databases are now available that catalogue milk-derived peptides and their associated biological activities, with a particular emphasis on antimicrobial potential [31,37]. Table 2 describes the main CDPs and their potential bacterial targets, as well as their amino acid sequence and names.
Table 2.
Antimicrobial peptides derived from casein: origin, sequence, target microorganisms, type of assay, and reported activity. NA—not available. Adapted from [31,36].
| Peptide | Name | Sequence | Type of Assay | Bacteria Inhibition | References |
|---|---|---|---|---|---|
| Alpha-S1-Casein | YLEQLLR | MIC (μg/mL) |
B. subtilis—53.6; E. coli NEB 5α—241.0; E. coli ATCC 25922—40.2 |
[75] | |
| Alpha-S1-Casein | Caseicin B | VLNENLLR | MIC (mM); well diffusion assay | (1) E. coli—0.22; C. sakazakii +++; L. innocua ++; L. bulgaricus ++; S. mutans ++, |
[76] |
| MIC (mg/mL) | (2) C. sakazakii—0.97 | [77] | |||
| MIC (mM) | (3) C. sakazakii—1.25; C. muytjensii—0.625 | [78] | |||
| Alpha-S1-Casein | TTMPLW | MIC (μM) | E. coli—193; S. aureus—193.0; M. luteus—64.0; C. albicans—144.0 | [79] | |
| Alpha-S1-Casein | Caseicin C | SDIPNPIGSENSEK | MIC (mM) | L. innocua—1.0 | [76] |
| Alpha-S1-Casein | RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKV | MIC (μg/mL) |
B. subtilis—29.0; E. coli NEB 5α—58.0; E. coli ATCC 25922—58.0 |
[75] | |
| Alpha-S1-Casein | RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEK | MIC (μg/mL) |
B. subtilis—59.0; E. coli NEB 5α—59.0; E. coli ATCC 25922—59.0 |
[75] | |
| Alpha-S1-Casein | RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGK | MIC (μg/mL) |
B. subtilis—31.4; E. coli NEB 5α—31.4; E. coli ATCC 25922—31.4 |
[75] | |
| Alpha-S1-Casein | RPKHPIKHQGLPQEVLNENLLRFF | MIC (μg/mL) |
B. subtilis—23.6; E. coli NEB 5α—47.2; E. coli ATCC 25922—189.0 |
[75] | |
| Alpha-S1-Casein | Isracidin | RPKHPIKHQGLPQEVLNENLLRF | MBC (mg/mL) | E. coli—0.1—1.0; | [80] |
| MIC (mg/mL) | C. sakazakii—0.5; E. coli—0.2 | [81] | |||
| Alpha-S1-Casein | RPKHPIK | MIC (μg/mL) |
Lactobacillus sakei A15—200.0; Escherichia coli K12—400.0; Bacillus megaterium F6—400.0 |
[82] | |
| Alpha-S1-Casein | CP1/Cpep11 | LRLKKYKVPQL | MIC (μM) | (1) E. coli ATCC 25922—64.0; E. coli UB1005—128.0; S. pullorum—256.0; Salmonella enterica subsp enterica CMCC 50071—256.0; S. aureus ATCC 29213—640.0, L. monocytogenes—65.0 |
[9] |
| MIC (μg/mL) | (2) B. subtilis—125; L. innocua—125.0; L. monocytogenes FSAW 2310—125.0; L. monocytogenes NCTC 11994—125.0; C. freundii—500; E. aerogenes—>1000; E. coli—250.0; S. enteritidis—250.0; S. thyphimurium—125.0 |
[83] | |||
| MIC (μg/mL) | (3) S. dysenteriae ATCC51302—300.0; E. coli ATCC 25922—250.0; Salmonella enterica serovar Typhimurium ATCC 14028—125.0; B. subtilis ATCC 9372—275.0; S.aureus ATCC25923—125.0; Streptococcus pneumoniae ATCC 49619—150.0 | [84] | |||
| Alpha-S1-Casein | LGYLEQLLRL | MIC (μg/mL) | B. subtilis—NA; E. coli NEB 5α—NA; E. coli ATCC 25922—1356.0 | [75] | |
| Alpha-S1-Casein | LEQLLRLKKY | MIC (μg/mL) | B. subtilis—1266.0; E. coli NEB 5α—633.0; E. coli ATCC 25922—NA | [75] | |
| Alpha-S1-Casein | Fragment of Isradicin | IKHQGLPQEV | MIC (μg/mL) and MBC (μg/mL) | E. coli—MIC 25.0–50.0, MBC 50.0; B. subtilis MIC 50.0, MBC 100.0 | [85] |
| Alpha-S1-Casein | Caseicin A | IKHQGLPQE | MIC (mg/mL) | (1) E. coli—2.0; L. monocytogenes—1.0; S. thyphimurium—2.0; P. putida—1.0; S. aureus—0.5 | [71] |
| MIC (mM) | (2) E. coli DPC6053—0.05 | [76] | |||
| MIC (mM) | (3) C. sakazakii—0.625; C. muytjensii—0.625; S. thyphimurium—1.25; E. coli—1.25; K. pneumoniae—1.25; P. fluorescens—1.25 | [78] | |||
| Alpha-S1-Casein | HIQKEDVPSERYLGYLEQLLRLKKYK | MIC (μg/mL) | B. subtilis—42.4; E. coli NEB 5α—169.0; E. coli ATCC 25922—NA | [75] | |
| Alpha-S1-Casein | HIQKEDVPSERYLGYLEQLLRLKK | MIC (μg/mL) | B. subtilis—186.0; E. coli NEB 5α—NA; E. coli ATCC 25922—NA | [75] | |
| Alpha-S1-Casein | HIQKEDVPSERYLGYLEQLLRLK | MIC (μg/mL) | B. subtilis—292.0; E. coli NEB 5α—292.0; E. coli ATCC 25922—584.0 | [75] | |
| Alpha-S2-Casein | PYVRYL | log(N0/Nf) |
E. coli—0.27; S. carnosus—2.23; S. epidermis—2.06; L. innocua—1.13 |
[86] | |
| Alpha-S2-Casein | WIQPKTKVIPYVRYL | MIC (μM) | C. sakazakii—78.125; L. monocytogenes—39.063 | [87] | |
| Alpha-S2-Casein | Casein F/CP2 | VYQHQKAMKPWIQPKTKVIPYVRYL | MIC (mM) | (1) B. subtilis—21; L. innocua—21; L. monocytogenes—21; C. freundii—664; E. coli—332; S. enteritidis—664; S. typhmirium—21, |
[83] |
| MIC (μM) | (2) C. sakazakii—312.5 L. monocytogenes—78.125 | [87] | |||
| MIC (μM) | (3) E. coli—16.0; L. innocua—16.0; B. cereus—16.0; M. flavus—16.0; St. thermophilus—8.0 | [88] | |||
| MIC (μg/mL) | (4) E. coli—8.0–16.0; S. carnosus—8.0–16.0, | [89] | |||
| MIC (μM) | (5) E. coli—1.25; S. choleraesuis—0.5; S. Epidermidis—2.5; L. monocytogenes—0.05 |
[90] | |||
| Alpha-S2-Casein | TVYQHQKAMKPWIQPKTKVIPYVRYL | MIC (μg/mL) |
B. subtilis—2.7; E. coli NEB 5α—21.4; E. coli ATCC 25922—172.0 |
[75] | |
| Alpha-S2-Casein | TKVIPYVRYL | MIC (μM) | C. sakazakii—156.25 L. monocytogenes—78.125 | [87] | |
| Alpha-S2-Casein | TKLTEEEKNRLNFLKKISQRYQKFALPQYLK | MIC (μg/mL) |
B. subtilis—4.0; E. coli NEB 5α—16.2; E. coli ATCC 25922—16.2 |
[75] | |
| Alpha-S2-Casein | P14 | TKKTKLTEEEKNRL | MIC (μM) |
B. cereus—2.99; S. aureus—2.3; L. monocytogenes—2.99 |
[91] |
| Alpha-S2-Casein | CR7 | QKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL | MIC (μg/mL) | B. subtilis—312.5; L. innocua—625.0 | [46] |
| Alpha-S2-Casein | P10 | QKALNEINQF | MIC (μM) |
B. cereus 0.87; S. aureus—1.75; L. monocytogenes 1.75; H. pylori—0.083 |
[91] |
| Alpha-S2-Casein | CR3 | LKTVYQHQKAMKPWIQPKTKVIPYVRYL | MIC (μg/mL) | B. subtilis—312.5; L. innocua—625.0 | [46] |
| Alpha-S2-Casein | CR5/CR6 | LKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL | MIC (μg/mL) |
B. subtilis—4.8; L. innocua—4.8; L. monocytogenes 2310—4.8 |
[46] |
| Alpha-S2-Casein | LKKISQRYQKFALPQY | MIC (μM) | E. coli—25.0; L. innocua—50.0; B. cereus—75.0; M. flavus—75.0; St. thermophilus—50.0 | [88] | |
| Alpha-S2-Casein | CR1 | KTVYQHQKAMKPWIQPKTKVIPYVRYL | MIC (μg/mL) |
B. subtilis—21.0; L. innocua—21.0; L. monocytogenes 2310—21.0; S. typhimirium—21.0 |
[46] |
| Alpha-S2-Casein | KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK | Diffusion Assay | E. coli—NA; S. carnosus—NA | [92] | |
| Alpha-S2-Casein | SR4 | KKISQRYQKFALPQYLKTVYQHQK | MIC (μg/mL) and MBC (μg/mL) | E. coli—MIC 50.0, MBC 100.0; B. subtilis MIC 12.5–25.0, MBC 50.0 | [85] |
| Alpha-S2-Casein | KAMKPWIQPKTKVIPYVRYL | MIC (μM) | C. sakazakii—39.063; L. monocytogenes—39.063 | [87] | |
| Alpha-S2-Casein | KAMKPWIQPKTKVIP | MIC (μM) | C. sakazakii—>1.250; L. monocytogenes—156.25 | [87] | |
| Alpha-S2-Casein | SR9 | KAMKPW | MIC (μg/mL) and MBC (μg/mL) | E. coli—MIC 150.0, MBC 300.0; B. subtilis MIC 150.0, MBC 600.0 | [85] |
| Alpha-S2-Casein | IVLNPWDQVK | MIC (μg/mL) | B. subtilis—1363.0; E. coli NEB 5α—681.0; E. coli ATCC 25922—1363.0 | [75] | |
| Alpha-S2-Casein | SR1 | IQPKTKVIPYVR | MIC (μg/mL) and MBC (μg/mL) | E. coli—MIC 50.0, MBC > 100.0; B. subtilis MIC 50.0, MBC > 100.0 | [85] |
| Alpha-S2-Casein | CR4 | ALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL | MIC (μg/mL) |
B. subtilis—10.7; L. innocua—10.7; L. monocytogenes 2310—10.7; S. typhimirium—21.4 |
[46] |
| Alpha-S2-Casein | SSSEESII | MIC (mM) | L. innocua ATCC 33090—0.205; Micrococcus luteus ATCC 4698—0.818; E. coli ATCC 25922—0.654; S. enteritidis ATCC13076—1.145 | [93] | |
| Alpha-S2-Casein | KTVDMESTEVFTKKTKLTEEEKNRLNFLKK | MIC (mM) | B. subtilis ATCC6633—3.10–6.67 | [94] | |
| Beta-Casein | YPVEPF | Diffusion assay | Bacillus spp.—NA; L. monocytogenes—NA | [95] | |
| Beta-Casein | Bc3 | EMPFPK | MIC (μg/mL) | E. coli PTCC 1399—60.0; S. aureus PTCC 1431—25.0 | [96] |
| Beta-Casein | Casecidin 17 | YQEPVLGPVRGPFPIIV | MIC (mg/mL) | E. coli DH5a—0.5; E. coli DPC6053—0.4 | [81] |
| Beta-Casein | Casecidin 15 | YQEPVLGPVRGPFPI | MIC (mg/mL) | E. coli DH5a—0.5; E. coli DPC6053—0.4 | [81] |
| Beta-Casein | Bc6 | VLPVPQK | MIC (μg/mL) | E. coli PTCC 1399—45.0; S. aureus PTCC 1431—25.0 | [96] |
| Beta-Casein | Bc8 | VKEAMAPK | MIC (μg/mL) | E. coli PTCC 1399—30.0; S. aureus PTCC 1431—10.0 | [96] |
| Beta-Casein | SR8/Bc5 | AVPYPQR | MIC (μg/mL) and MBC (μg/mL) | (1) E. coli—MIC 100.0, MBC > 100.0; B. subtilis MIC 50.0, MBC > 100.0 | [85] |
| MIC (μg/mL) | (2) E. coli PTCC 1399—40.0; S. aureus PTCC 1431—20.0 | [96] | |||
| Beta-Casein | VPYPQRDMPIQAFL | MIC (μg/mL) | E. coli NEB 5α—493.0 | [75] | |
| Beta-Casein | Bc14 | VLPVPQKAVPYPQR | MIC (μg/mL) | E. coli PTCC 1399—30.0; S. aureus PTCC 1431—10.0–15.0 | [96] |
| Beta-Casein | RINKK | MIC (mM) | E. coli 2.59 | [97] | |
| Beta-Casein | Bc11 | HKEMPFPK | MIC (μg/mL) | E. coli PTCC 1399—50.0; S. aureus PTCC 1431—20.0 | [96] |
| Beta-Casein | Bc12 | EAMAPKHK | MIC (μg/mL) | E. coli PTCC 1399—30.0; S. aureus PTCC 1431—15.0 | [96] |
| Beta-Casein | Bc1 | EAMAPK | MIC (μg/mL) | E. coli PTCC 1399—60.0; S. aureus PTCC 1431—25.0 | [96] |
| Beta-Casein | LGDT2 | VAGTWY | log(N0/Nf) | B. subtilis—2.2 | [98] |
| Beta-Casein | LGDT1 | IPAVFK | log(N0/Nf) | (1) B. subtilis—2.2; S. zooepidemicus—0.4 | [98] |
| MIC (μg/mL) | (2) E. coli—55.0; S. aureus—30.0 | [99] | |||
| Beta-Casein | IDALNENK | log(N0/Nf) | (1) L. monocytogenes—0.72; S. aureus—1.03; E. coli—0.63 | [99] | |
| log(N0/Nf) | (2) E. coli—70.0; S. aureus—35.0 | [100] | |||
| Beta-Casein | LGDT3 | VLVLDTDYK | log(N0/Nf) | B. subtilis—2.4 | [98] |
| Beta-Casein | TPEVDDEALEK | log(N0/Nf) | L. monocytogenes—1.03; S. aureus—1.23; E. coli—0.69 | [100] | |
| Beta-Casein | IRL | log(N0/Nf) | L. ivanovii—NA; E. coli—NA | [101] | |
| Beta-Casein | LGDT4 | AASDISLLDAQSAPLR | log(N0/Nf) |
B. subtilis—1.5; S. lentus—1.5; S. zooepidemicus—0.6 |
[98] |
| Kappa-Casein | Kappacin | MAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV | MIC (mg/mL) | (1) E. faecalis—0.64 | [102] |
| MIC (μg/mL) | (2) S. mutans—59.0 | [103] | |||
| Kappa-Casein | YVL | log(N0/Nf) |
E. coli—> 6; S. maracescens—3.08; L. innocua—> 6.0; S. carnosus > 6.0 |
[97] | |
| Kappa-Casein | IQY | log(N0/Nf) |
E. coli—> 6.0; S. maracescens—0.39; L. innocua—0.27; S. carnosus—0.22 |
[97] | |
| Kappa-Casein | YYQQKPVA | log(N0/Nf) |
E. coli—3.46; S. maracescens—0.04; L. innocua—0.66; S. carnosus—1.14 |
[97] | |
| Kappa-Casein | VQVTSTAV | log(N0/Nf) |
E. coli—0.10; S. maracescens—0.25; L. innocua—1.99; S. carnosus—1.17 |
[97] | |
| Kappa-Casein | VESTVATL | log(N0/Nf) |
E. coli—>6; S. maracescens—0.59; L. innocua—1.89; S. carnosus—3.44 |
[97] | |
| Kappa-Casein | SR13 | TEAVESTVATL | MIC (μg/mL) | E. coli—50.0; B. subtilis—50.0 | [85] |
| Kappa-Casein | STVATL | log(N0/Nf) |
E. coli—0.67; L. innocua—0.42; S. carnosus—0.29 |
[97] | |
| Kappa-Casein | PAAVRSPAQILQ | log(N0/Nf) |
E. coli—>6.0; S. maracescens—0.20; L. innocua—0.84; S. carnosus—0.97 |
[97] | |
| Kappa-Casein | MMK | MIC (μg/mL) | E. coli—125.0; S. aureus—70.0 | [104] | |
| Kappa-Casein | MAIPPKKNQDKTEIPTINT | MIC (mg/mL) | E. coli—0.25 | [105] | |
| Kappa-Casein | IAK | MIC (μg/mL) | E. coli—100.0; S. aureus—60.0; L. casei—70.0; L. acidophilus—70.0 | [103] | |
| Kappa-Casein | FSDKIAK | log(N0/Nf) |
E. coli—>6.0; S. maracescens—0.27; L. innocua—>6.0; S. carnosus—>6.0 |
[97] | |
| Kappa-Casein | FFSDK | MIC (μg/mL) | E. coli—200; S. aureus—90 | [104] | |
| Kappa-Casein | EIPT | log(N0/Nf) |
E. coli—2.59; S. maracescens—1.69; L. innocua—0.88; S. carnosus—0.74 |
[97] | |
| Kappa-Casein | AVESTVATLEDSPEVIESPPE | MIC (μg/mL) | S. mutans—59.0 | [103] |
MIC: Minimum Inhibitory Concentration; MBC: Minimum bactericidal concentration.
Considering their origin, casein-derived antimicrobial peptides (CDAMPs) target a broad range of bacterial pathogens [59]. From the α-S1-casein fraction, several peptides have been identified. For example, isracidin inhibits E. coli DH5a, E. coli DPC6053, Cronobacter sakazakii, and others. A fragment of isracidin also shows activity against E. coli and B. subtilis [80,81]. Caseicin A, derived from α-S1-casein, targets E. coli, C. sakazakii, L. innocua, L. bulgaricus, and S. mutans. Similarly, caseicin B and caseicin C also inhibit E. coli, C. sakazakii, and L. innocua, among others [71,76,77,78]. Additionally, peptides such as CP1, derived from α-S1-casein, show antibacterial activity against B. subtilis, L. monocytogenes, S. Enteritidis, S. Typhimurium, and other strains [9,83,84]. These peptides are particularly noted for their broad-spectrum activity, which includes both Gram-positive and Gram-negative bacteria.
The α-S2-CDP group, including various fragments like casocidin, also exhibit notable antibacterial effects. Casein F targets pathogens such as E. coli, S. carnosus, B. subtilis, and L. monocytogenes [72,87,88,89,90]. Other peptides derived from this fraction, like CR1, CR3, and CR5/6, show inhibitory effects against a range of bacteria including L. innocua, B. cereus, S. aureus, and S. Typhimurium [46,93]. Additionally, p10 and p14 peptides from α-S2-casein have activity against B. cereus, S. aureus, L. monocytogenes, and H. pylori [91].
From the β-casein fraction, peptides like casecidin 17 and others such as Bc3, Bc6, and Bc8 show significant antimicrobial activity against E. coli [96]. These peptides have also been reported to inhibit B. cereus, L. monocytogenes, and B. thuringiensis. The β-CDP group primarily targets E. coli, demonstrating its role in combating enteric infections [81,85,97].
Lastly, peptides derived from κ-casein exhibit antimicrobial properties against a variety of pathogens including E. coli, S. marcescens, L. innocua, and S. carnosus. Some of the κ-CDP group also target S. aureus, L. casei, and L. acidophilus, making them effective against both Gram-positive and Gram-negative bacteria [85,97,103,104].
Overall, the CDPs listed in Table 2 shows promising antibacterial properties against a wide spectrum of pathogens, indicating their potential for use in food safety and therapeutic applications. As we can see, CDPs have shown effectiveness against both Gram-positive and Gram-negative bacteria, including common foodborne pathogens, namely Salmonella spp., that are a leading cause of foodborne illness worldwide, affecting millions each year in the U.S.A. and Europe [106]. Listeria monocytogenes, the agent responsible for listeriosis that is a rare but serious disease with a high fatality rate (20–30%), remains a significant public health concern, particularly in ready-to-eat foods [107]. Shiga toxin-producing Escherichia coli (STEC) is also responsible for severe foodborne outbreaks [108]. Although less serious, Staphylococcus aureus can cause food poisoning when enterotoxins are produced in improperly handled or stored foods [109].
These peptides’ ability to target both Gram-negative and Gram-positive bacteria highlights their versatility and potential as natural antimicrobial agents. Overall, α-S1-CDPs are the most studied. These peptides are noted for their broad-spectrum antibacterial activity, targeting a wide range of bacterial strains [71,76,77,78,79,81].
As for the bacteria, E. coli is the most frequently mentioned in the studies, and it is the target for many of the peptides derived from α-S1-casein, α-S2-casein, β-casein, and κ-casein. E. coli is particularly prevalent in the list, with various strains such as E. coli DH5a, E. coli NEB 5α, E. coli ATCC 25922, and others being commonly referenced as targets for these peptides [9,75,79,81,85,88,97,104]. This suggests that many of these CDPs are effective against E. coli, a major pathogen in both human and animal health, particularly in gastrointestinal infections. [74,110].
In a more recent study by Shizhe Qi and his colleagues, casein-derived antimicrobial peptide mixtures were generated via optimized proteolysis, showing strong inhibitory effects against Streptococcus mutans and Porphyromonas gingivalis, including disruption of bacterial membranes and biofilm formation. Proteomic analysis identified 301 potential CDPs, with four novel peptides confirmed synthetically [111].
In Silico Prediction and Peptidomic Characterization of CDAMPs
In recent years, in silico methodologies have emerged as powerful tools in the identification and characterization of casein-derived AMPs, offering a complementary and time-efficient alternative to traditional biochemical approaches. These strategies accelerate the discovery pipeline by enabling rapid screening of peptide sequences, prediction of bioactivity, and assessment of safety profiles. For instance, a study employing the BIOPEP-UWM platform simulated gastrointestinal digestion of goat milk proteins, identifying 83 potential AMPs, with β-casein contributing the highest number of candidates [112]. These peptides were subsequently evaluated using machine learning algorithms to predict potential antimicrobial activity, along with assessments of potential physicochemical properties, toxicity and allergenicity by analyzing their amino acid sequences and predicting their likelihood of eliciting an immune response [112]. From this dataset, peptide sequences such as YLEQLLR and VLNENLLR derived from β-casein were computationally predicted to exhibit antimicrobial activity against Listeria monocytogenes, Escherichia coli, and Salmonella enterica, and these predictions were later validated through in vitro assays [112]. A related investigation extended this approach to the proteomes of goat and sheep milk, as well as feta cheese, employing an in silico workflow to predict and characterize AMP candidates. Peptides were ranked based on antimicrobial potential and stability against gastrointestinal proteases, providing insight into their likely functionality in physiological conditions [113]. In parallel, recent advances in mass spectrometry-based peptidomics have substantially enhanced the empirical identification of bioactive casein peptides. In a 2017 study, the peptide composition of casein hydrolysates generated under various enzymatic hydrolysis conditions was investigated through mass spectrometric analysis [114]. The authors identified a total of 70 unique peptides, including 28 from αs1-casein, 21 from αs2-casein, 13 from β-casein, and 8 from κ-casein. Most peptides had molecular weights below 5000 Da, with the majority falling in the range 1000–1500 Da. All peptides were predicted to be non-toxic and non-allergenic, and several exhibited high bioactivity scores as determined by PeptideRanker analysis [114].
3.3. Mechanisms of Action of CDPs
Milk-derived peptides exhibit diverse antibacterial mechanisms and have been extensively studied [23]. Their antimicrobial activity arises from several key actions, including bacterial membrane disruption, inhibition of cell wall synthesis, and interference with bacterial metabolism [23]. Structural features such as amino acid composition, hydrophobicity, and net charge play a critical role in determining their bioactivity [115,116,117]. It has been proposed that these peptides act through multiple simultaneous mechanisms, and a group target model has been suggested to describe this complex mechanism of action [115,116,117]. Figure 3 depicts the main mechanisms of CDAMPs.
Figure 3.
Proposed mechanisms of action of casein-derived antibacterial peptides, including membrane disruption, pore formation, inhibition of intracellular targets (e.g., DNA/RNA synthesis), and interference with metabolic pathways. Adapted from [8,14,46].
CDAMPs’ antimicrobial properties are primarily due to their cationic and amphipathic nature. Their positive charge enables interactions with the negatively charged bacterial membranes, where they can insert into the lipid bilayer, disrupting membrane integrity and increasing permeability. This results in the leakage of essential ions and nutrients, leading to bacterial cell death [116,118]. CDPs are effective against both Gram-positive and Gram-negative bacteria, including Escherichia coli and Staphylococcus aureus [53,118]. Casecidi acts by forming pores in the bacterial membrane, causing uncontrolled leakage of cellular contents and ultimately leading to cell death [53]. In contrast, peptides like αS1-CDP destabilize the membrane by thinning the lipid bilayer, further compromising its structural integrity [119,120]. Some CDPs also disrupt bacterial membranes by destabilizing the electrochemical gradient and hindering ATP production via ion channel interference [14]. Beyond membrane disruption, some CDPs interfere with intracellular processes, such as DNA and RNA synthesis, as β-CDPs which have been shown to interact with dihydrofolate reductase and DNA gyrase in S. aureus, impairing bacterial replication [121]. β-casein-derived peptides have also been shown to interact with key enzymes like dihydrofolate reductase and DNA gyrase, impairing bacterial replication and contributing to their antimicrobial efficacy [121]. Additionally, CDPs can also generate reactive oxygen species (ROS), contributing to further damage of bacterial cells and enhancing their bactericidal effects [122].
Notably, several CDAMPs appear to exert antibacterial effects primarily against pathogenic strains, with minimal or no reported activity against beneficial dairy-associated bacteria. This selective behavior is likely related to differences in membrane composition and electrostatic properties and may reflect a broader trend observed in other milk-derived peptides. Their cationic charge facilitates binding to negatively charged membranes, while their amphipathic structure allows them to penetrate the lipid bilayer, disrupting membrane integrity and increasing permeability [115,118]. Additionally, some peptides may have specific features that target specific pathogens: GMp7 (KVLPVPQ), a milk-derived antimicrobial peptide described in 2025, was shown to be highly effective against S. aureus due to specific structural features that contributed to its selectivity [123]. Also, certain peptides, such as αs165-181, have been found to bind to specific pathogenic genomic DNA [124]. In summary, CDPs are versatile antimicrobial agents that function through multiple mechanisms, but require further investigation into their effects on beneficial microbiota and potential applications in clinical settings.
It is noteworthy that, besides CDPs’ antibacterial activity, several studies have explored the antifungal activity of CDPs, although this area of research is less explored. One relevant study showed that casein protein hydrolysates from cows’ milk exhibited antifungal activity against Candida krusei, with inhibition rates varying depending on the type of hydrolysis and the peptide concentration. These hydrolysates showed effectiveness not only against Candida species but also against other pathogenic fungal species, suggesting that casein could be a valuable source for the development of natural antimicrobial compounds [125]. Furthermore, peptides derived from goat milk casein, when hydrolyzed by enzymes such as trypsin, also exhibited antifungal effects against species like Candida albicans. [126]. These studies indicate that CDPs, in addition to their antimicrobial properties, also hold potential as antifungal agents, providing a natural and effective alternative for the control of fungal infections, both in medicine and in the food industry, as natural preservatives.
4. Practical Applications of CDPs
Caseins and CDPs present several features that render them good candidates for several applications for both food and health settings. On the one hand, casein’s well-known ability to form micelles greatly enhances its potential as a carrier for biologically active agents. This property not only increases the stability of encapsulated compounds but also improves their bioavailability, further making casein an excellent candidate for the delivery of bioactive molecules, including drugs, dietary supplements, and functional food ingredients, which has been broadly researched [20]. Another feature is casein and CDPs’ ability to combine with metal ions, allowing the formation of metal–protein complexes with interesting bioactivities. Qu et al. used casein peptides derived from dairy waste to capture Cu2+ from industrial wastewater, forming CPs/Cu/Cu2O nanoparticles, which in turn exhibited strong antibacterial activity against E. coli, S. aureus, and multidrug-resistant strains from livestock wastewater by generating reactive oxygen species and releasing Cu2+ [127]. Additionally, CDAMPs have become increasingly significant due to their promising applications as functional ingredients and nutraceuticals. While their natural origin appeals to both consumers and producers looking for safer, more sustainable alternatives to synthetic preservatives [128,129], several studies indicate CDPs are non-toxic and non-allergenic, further supporting their use in both food and pharmaceutical products [114]. Corroborating this is a growing body of evidence that focuses on improving the production processes of these peptides, as well as finding novel methods to stabilize them in different food and health-related products. Overall, the possible practical applications of CDAMPs are summarized in Figure 4 and comprise several areas of interest in both food and health systems. These are described in further detail below.
Figure 4.
Possible practical applications of casein-derived peptides in food and clinical systems.
4.1. Application in the Food Industry
The global market for milk-based products and ingredients is expanding steadily, being valued at USD 13.67 billion in 2024 and expected to grow at a compound annual growth rate (CAGR) of 6.3% from 2025 to 2030. A key driver of this expansion is the increasing demand for protein-fortified foods and beverages, particularly those enriched with milk protein hydrolysates, due to their enhanced digestibility and functional properties. This trend is especially significant in developed regions such as Europe and North America, where health-conscious consumers are increasingly opting for convenient, nutrient-dense options such as functional yogurts, protein bars, and ready-to-drink formulations [130]. Whey protein concentrate (WPC) and whey protein isolate (WPI) are widely used in the protein ingredient market due to their cost-effectiveness, solubility, and emulsification capacity [131]. However, casein and casein bioactive peptides derived from casein are increasingly appreciated for their distinctive bioactivity and functionality [37,132]. Today, casein’s mineral absorption and binding properties are extensively explored in industrial contexts, especially in the development of beverages such as sports drinks designed for mineral supplementation, as well as in clinical nutrition for disease management [37]. CDPs such as casomorphins and isracidin are incorporated into functional foods and nutraceuticals due to their ability to exert antioxidant, antimicrobial, and antihypertensive effects [37,132]. CDPs also show promise as ingredients in hypoallergenic products, such as infant formulas, where they can contribute to immunomodulation and reduce allergic responses [76]. Additionally, they help in enhancing the sensory attributes of foods by providing improved texture and stability. In dairy processing, fortification with micellar casein enhances the rheological and functional characteristics of yogurt [133] and β-casein has been shown to prevent the degradation of anthocyanins such as those found in blueberries [134]. Additionally, functional properties of casein can be improved through glycation with polysaccharides, which enhances emulsifying and foaming behavior, making it suitable for applications such as emulsifiers and for encapsulating bioactive molecules [135].
4.1.1. Food Preservation and Safety
Several reports substantiate that CDPs can be natural alternatives to synthetic preservatives, which are often criticized for potential health risks [136,137,138,139,140]. Kappacin and isracidin have been incorporated into dairy products, meats, and other perishable foods, showing promise in different food matrices [82,136]. Although some reports suggest peptide degradation remains a concern in food matrices, limiting its action time [136], casein-derived casocidin and isracidin [137] have shown resistance to microbial proteolysis, especially in yogurt starter strains, which supports their use as preservatives at low pH. BCp12 maintains antimicrobial activity under various salt concentrations, although it remains sensitive to high temperatures and enzymatic degradation [138]. The γ s165-181 peptide from ovine milk presents antimicrobial activity against various bacteria in food products like minced beef and UHT cream [123]. On this matter, CDPs’ natural antioxidant activity in meat processing is also promising as an alternative to synthetic antioxidants, which are often scrutinized for potential health risks [141,142]. While primarily studied in beef and poultry, these peptides could potentially be applied to other meat products, enhancing their quality and shelf life [142,143].
CDAMPs also play a natural and crucial role in fermented foods, providing a source of antimicrobial agents that inhibit spoilage and pathogenic microorganisms, contributing to product safety and extending shelf life [140]. Caseicidin and isracidin, naturally produced during casein hydrolysis, have been explored for their potential to inhibit pathogenic bacteria in dairy-based functional foods [144,145,146]. CDPs produced by Lactobacillus acidophilus fermentation have shown potential in bioprotective applications, particularly in milk-based formulas to prevent infections like those caused by Cronobacter sakazakii [76]. Whey protein films incorporating casein peptides have also been used to improve the microbial stability of refrigerated soft cheese, effectively inhibiting the growth of bacteria such as E. coli and B. subtilis [147].
4.1.2. Food Packaging
The incorporation of CDPs into food packaging materials has also emerged as a promising strategy to enhance food preservation. In a broader sense, AMPs from different sources have been successfully integrated into films, coatings, and pouches, creating active packaging systems capable of extending the shelf life of perishable foods, and have been extensively reviewed elsewhere [148,149,150,151]. In the case of casein, its unique properties, especially high thermal stability, biodegradability, and micelle and emulsification forming capacity, as well as ability to bind metal ions, makes it an excellent biomaterial for edible coatings [20]. Active casein coatings and films can effectively extend the shelf life of perishable foods by hindering decay kinetics and incorporating bioactive compounds, such as phenolic acids, allowing a controlled release of antimicrobial agents into the food environment, reducing spoilage. β-casein, in particular, can be highly effective in carrying small molecules and ions due to its hydrophobic domain [152]. The interaction of bioactive additives with casein, and how they affect the structural properties of coatings and films, has been reviewed elsewhere [152]. Notably, the incorporation of phenolic acids and essential oils (e.g., cinnamon and lemongrass) enhanced the preservation of sensory and nutritional quality in fresh produce, even offering an alternative to nanoparticles and probiotics, while being biocompatible and biodegradable [147].
4.1.3. Functional Foods
In the context of functional foods, all types of bioactive peptides can be added or enriched through modifications to standard manufacturing processes, such as altering process parameters or changing starter cultures. Some traditional foods have been redefined with innovative marketing strategies and this has become a growing market niche. The incorporation of CDPs into functional food formulations has been shown to improve gastrointestinal health, reduce inflammation, and enhance immune responses [20]. Furthermore, research has indicated that the fermentation process in dairy products can release these peptides, enhancing their bioactivity and health benefits [20]. Currently, CDPs can be incorporated into a range of functional foods, including protein-enriched beverages, sports nutrition products, and infant formulas [116]. For instance, bioactive peptides with antioxidant properties, such as casomorphins and lactoferricin-derived peptides, are being integrated into fortified dairy drinks and energy bars to enhance their health benefits [116]. Additionally, casein hydrolysates are increasingly used in health and medical nutrition [152] and can also provide a delivery system for antibacterial casein-derived peptides, such as caseicin A [153]. Examples of commercially available functional foods and ingredients containing casein-derived bioactive peptides are provided in Table 3. These applications have been a common trend in food markets for several years and have been reviewed [37,132]. All of them are aimed at casein’s health benefits, namely hypotensive, mineral absorption, and stress-reducing activities.
Table 3.
Examples of commercially available functional foods or food ingredients containing casein-derived bioactive peptides. Adapted from [37,132].
| Product Name | Manufacturer | Type of Food | Peptide Name |
|---|---|---|---|
| Calpico (Europe) or Calpis AMEAL S (Japan) | Calpis Co., Japan | Fermented milk | B ioactive peptides Ile-Pro-Pro (IPP) and Val-Pro-Pro (VPP) from b- and k-CN |
| Capolac | Arla Foods, Denmark | Ingredient | Casein phosphopeptides |
| Casein DP Peptio Drink | Kanebo, Japan | Soft drink | Casein-derived dodecapeptide FFVAPFPEVFGK |
| CE90CPP | DMV, Netherlands | Ingredient | Casein phosphopeptides (CPPs) |
| C12 Peptide | DMV, Netherlands | Ingredient | Casein-derived dodecapeptide FFVAPFPEVFGK |
| Evolus | Valio, Finland | Fermented milk, calcium enriched | C12 |
| Kotsu Kotsu calcium | Asahi, Japan | Soft drink | CPP |
| PeptoPro | DSM Food Specialists, Netherlands | Ingredient | Hydrolyzed casein |
| ProDiet F200 | Ingredia, France | Milk Drink, Confectionary | CPP |
| Tekkotsu Inryou | Suntory, Japan | Soft drink | CPP |
| Peptigen® IF-3080 | Arla Foods, Denmark | Infant formulas | Casein hydrolizates |
Of course, one of the most common approaches is the use of fermented dairy products such as yogurt, kefir, and cheese, where proteolytic enzymes from lactic acid bacteria generate CDPs with enhanced bioactivity. Several reports have shown the presence of CDPs in dairy products [154,155], and processed dairy products such as cheeses and fermented milk [34,51,155,156,157,158].
4.2. Pharmacological Applications
Beyond their established nutritional role, casein proteins from milk exhibit remarkable potential in pharmaceutical applications. Technological advancements in nano-delivery systems—such as liposomes, electrospun nanofibers, and polymeric nanoparticles [159,160,161]—have improved the protection of peptides from degradation and facilitated their controlled release in pharmaceutical, and cosmetic formulations. There are currently several pharmaceutical applications for casein-derived peptides that exhibit promising therapeutic effects in the management of hypertension, diabetes, and coagulation disorders [162,163,164], including innovative delivery methods such as casein-based hydrogels developed for the delivery and sustained release of biomolecules [165].
Regarding CDPs’ antimicrobial activities, they present several advantages as therapeutic alternatives: (1) they present rapid bactericidal activity; (2) they have broad-spectrum efficacy; (3) they act faster than bacterial replication rates, which may help prevent the development of antimicrobial resistance [37]; and (4) they are structurally suited to rapid absorption and targeted activity [166,167]. Moreover, CDPs have shown compatibility with conventional medications and generally exhibit minimal adverse effects [71].
Accordingly, there is a growing body of evidence that in both human and veterinary medicine, CDPs offer promising alternatives to traditional antibiotics, particularly in addressing antimicrobial resistance in livestock and antimicrobial resistant bacteria [136]. Kappacin, for instance, has shown significant antibacterial activity. A combination of kappacin and Zn2+ was demonstrated to suppress the in vitro growth of oral cariogenic bacteria, including biofilm formation, for extended periods [168]. Recent trials using human volunteers confirmed that a mouthrinse solution containing a glycomacropeptide (GMP)/kappacin formulation (1.33 mM) and zinc (ratio 1:15) exhibited comparable efficacy to chlorhexidine mouthrinses (0.05%) against dental plaque. This combination prompted the commercialization of a new product for treating oral diseases [169,170].
In the context of mastitis, a prevalent and costly disease in dairy cattle, CDPs such as isracidin have been found to exhibit strong antimicrobial properties. In a study, intramammary infusion of isracidin showed a significant reduction in somatic cell count, effectively curing mastitis in 90% of infected cows, caused by S. aureus and other bacteria that were resistant to conventional antibiotics [80]. In a similar acute mastitis model, the intramammary injection of isracidin (two doses of 2 g each) successfully treated 71% of udder quarters in cows previously infected with resistant S. aureus [80].
Furthermore, CDPs have shown promise in treating systemic infections. In a study, a single intramuscular injection of isracidin effectively protected mice against subcutaneous infections caused by S. aureus, Streptococcus pyogenes, and Listeria monocytogenes [80]. This study demonstrated that isracidin provided protection for at least five months, and treated mice survived a second S. aureus 8126 infection in the fifth month, unlike the control mice, where only around 10% survived the first infection. The protective effect was also observed in other animal models, including rabbits, guinea pigs, and sheep. In these models, isracidin was injected before infection with S. aureus strains, showing its effectiveness in preventing infection [80].
These findings support the potential of CDPs as alternatives to antibiotics, particularly in veterinary medicine, where resistance to conventional antibiotics remains a significant challenge.
4.3. Isolation, Stability, and Delivery Systems
Despite several health benefits and functionalities, consumption of bioactive peptides derived from casein is often limited by their undesirable flavor or bitter taste, low solubility, poor stability during processing, and poor oral bioavailability [159]. A key challenge is to enhance their bioavailability from natural sources or to formulate novel food products through the addition and/or fortification of isolated or concentrated peptide fractions.
Casein production in CDP isolation relies on manipulating the physicochemical properties of casein micelles, colloidal particles that precipitate at their isoelectric point (pH 4.6) [171]. Acid coagulation is a common method, destabilizing micelles and causing casein precipitation through calcium and phosphate removal [172]. Enzymatic coagulation, involving chymosin-mediated cleavage of κ-casein, generates gel-like structures under optimal conditions of pH 5.1–5.3 [173,174]. Coagulation can also be influenced by external factors such as pressure and CaCl2 addition [175]. Heat coagulation (130–150 °C) is another technique, with micelle size and milk composition affecting coagulation efficiency [176,177]. Microfiltration, utilizing 0.1 μm membranes, allows for the concentration of micellar casein, though efficiency can be impacted by membrane fouling and salt addition [133,178]. A more recent approach, high-pressure CO2 coagulation, preserves micelle stability by maintaining near-neutral pH and enhances rheological properties [179,180]. Chromatographic methods such as reverse-phase and ion-exchange chromatography are used for casein fractionation, with efficiency dependent on column type and mobile phase composition [181,182].
The functional properties of casein, including solubility and moisture-binding capacity, are critical for its applications. Casein solubility increases with pH adjustments and enzymatic hydrolysis [183], while its water-binding capacity is enhanced by the micellar structure and can be further increased through enzymatic treatments [183,184].
A significant challenge in harnessing the antibacterial potential of CDPs lies in their stability during digestion and food processing. These peptides, often sensitive to enzymatic degradation, can lose their antimicrobial activity when exposed to the acidic environment of the stomach or digestive enzymes. On this matter, the use of casein hydrolysate was shown to improve the bioavailability and antioxidant efficacy of CDPs, with acidic peptide fractions having higher bioavailability and resistance to digestive enzymes and intestinal peptidases [185]. Additionally, food processing conditions, such as heat or high pressure, may compromise the integrity of these peptides, diminishing their effectiveness. It has been reported that controlling enzyme/substrate ratio and hydrolysis time of bioactive peptides derived from casein hydrolysates can enhance both production and efficacy of CDAMPs [114]. A total of 70 unique peptides were identified using different enzyme/substrate ratio (E/S) and hydrolysis times, predominantly from αs1-casein. The authors showed that an increase in E/S ratio and hydrolysis time led to a decrease in peptide number. In silico analyses indicated that all peptides were non-toxic and non-allergenic, with several displaying high bioactivity potential according to PeptideRanker scores. These findings highlight the relevance of production conditions in tailoring the release of functional peptides, supporting their potential application in the functional food industry.
A growing number of studies have explored various delivery systems, such as micro and nano-encapsulation, nanocarriers, and hydrogels, to optimize and safeguard the release and preservation of peptides [186,187,188,189,190,191]. CDPs incorporated into nanostructured delivery systems have been successfully used to target gastrointestinal pathogens. A study by Wenck et al. (2024) [192] reported casein-coated and drug-loaded magnetic nanoparticles for theranostic applications. Also, casein peptide-loaded nanocarriers for enhanced antibacterial activity could be of use, as suggested by Lombardi et al. (2024) [193]. In food systems, delivery technologies such as edible films or emulsions have also been investigated for the incorporation of CDPs [194,195]. These systems not only protect the peptides from environmental factors but also offer controlled release, ensuring their effectiveness over time. For example, casein-derived antimicrobial peptides incorporated into food coatings have been shown to extend the shelf life of perishable products by inhibiting bacterial growth, without affecting food quality [138,196].
For clinical approaches, self-assembling peptide-based hydrogels are a promising offer regarding biocompatibility, biodegradability, and spatiotemporal control for precise wound healing and tissue repair [197]. Topical antimicrobial peptide formulations with high stability are also a growing trend, which could incorporate CDPs [198]. Oral mucosal casein salt films show good compatibility and desired drug release with no side effects, offering a biodegradable and effective drug delivery system for anti-diabetic drugs [199]. More advanced technologies such as nanoencapsulation of CDPs within electrospun nanofibers have also emerged [159].
Interestingly, despite the challenges in delivering CDPs, several studies suggest that casein-based formulations are themselves an excellent delivery system for controlled release systems, with applications in drug delivery for both hydrophilic and hydrophobic drugs, offering sustained release, improved bioavailability, and biocompatibility [200,201,202,203,204,205].
4.4. Safety and Regulatory Aspects of Casein-Derived Bioactive Peptides
Casein hydrolysates and specific peptides such as Val-Pro-Pro and Ile-Pro-Pro have been extensively evaluated for safety, showing no evidence of target organ toxicity or adverse effects in animal studies. Studies by Maeno et al. (2005) and Mizuno et al. (2005) reported no lowest observed effect level (LOEL) or maximum tolerated dose (MTD) below 2 g/kg/day in rats [206,207]. Long-term administration also showed no negative reproductive or developmental effects [208]. Tensguard®, a functional ingredient containing Ile-Pro-Pro, was found to be non-mutagenic and exhibited a no observed adverse effect level (NOAEL) equivalent to 2 g/kg/day [209].
Several bioactive peptides derived from casein, such as lactotripeptides (e.g., IPP and VPP), have demonstrated beneficial effects, including antimicrobial activity and blood pressure regulation. While specific casein-derived peptides have shown promising health benefits, regulatory approvals typically apply to casein hydrolysates as ingredients in food formulations. These peptides, often present in hydrolysates, are recognized for their bioactive properties but are not yet individually regulated for use in food products.
In terms of regulation, casein and caseinates are covered under EU regulations (EC 2921/90; EC 760/2008), but casein hydrolysates do not currently possess GRAS status or approved health claims in Europe (EFSA, 2009a). Therefore, they are subject to safety evaluations by regulatory authorities such as the European Food Safety Authority (EFSA). Recently, the EFSA allowed hydrolysates like Peptigen® IF-3080 in infant formulas. Such hydrolysates are expected to be formalized in the EU regulations (Regulation (EU) 2016/17). Similar regulatory frameworks are in place in other regions, including Australia, New Zealand (FSANZ), and the United States (FDA), where casein hydrolysates are permitted in food products, provided they meet safety standards. Other specific casein-derived peptides such as β-casomorphin-7 (BCM-7) have been evaluated and found to pose no health risk (EFSA, 2009b). Iron milk caseinate was also authorized as a novel food in the EU in 2023 (EU) (2023/949). Specifically, its use is permitted in food for special medical purposes, certain foods, and food supplements, subject to certain conditions.
Conversely, Japan has developed a legal framework (FOSHU) for the use of functional foods since 1991, allowing scientific validation of health claims. Under this system, peptides like Val-Pro-Pro, Ile-Pro-Pro, Val-Tyr [210], and casein phosphopeptides (CPPs) [211] have been approved for anti-hypertensive and mineral bioavailability applications.
To ensure both efficacy and safety, validated biomarkers are required to assess the physiological impact of these peptides, alongside toxicological assessments to ensure absence of cytotoxicity, allergenicity, and other adverse effects [114,212,213,214].
5. Conclusions and Future Perspectives
Milk proteins, particularly casein, are among the most thoroughly studied precursors of bioactive peptides. Recent advances continue to unveil novel biological activities and novel amino acid sequences. The growing number of identified casein-derived peptides reflects increasing scientific interest in their multifunctional potential. These peptides exhibit unique structural and functional properties, with well-documented antimicrobial activity among other bioactivities. Their applications are expanding across the food sector—as natural preservatives, functional ingredients, and components in active packaging—as well as in pharmacological contexts, where they are emerging as viable and effective alternatives to conventional antibiotics, including evidence of in vivo efficacy. Despite challenges related to their inherent instability and sensitivity, particularly in delivery systems, recent advances have introduced promising strategies to ensure safe, efficient, and targeted delivery of these peptides. The growing interest in functional foods has led to the incorporation of several casein-derived peptides into commercial food products. This progress has been largely enabled by developments in large-scale processing technologies, such as membrane separation, ultrafiltration, and nanofiltration, which facilitate the isolation and concentration of specific peptides. Moreover, encapsulation strategies—including micro- and nanoencapsulation—offer innovative solutions to improve peptide stability during food processing and gastrointestinal digestion, thus enhancing their functional efficacy in complex food matrices.
From a regulatory standpoint, the progressive acceptance of casein hydrolysates and bioactive peptides highlights a positive trend toward their integration into food and health-related applications, but a lot remains to be accomplished. A key research priority is the accurate quantification and optimization of the bioavailability of bioactive peptides in different food systems. Finally, the incorporation of bioactive peptides into food products must be accompanied by safety evaluations and compliance with regulatory frameworks. This is particularly relevant when health claims are proposed, since regulatory bodies require robust scientific substantiation to approve such claims. Addressing these regulatory aspects will be crucial for the broader acceptance and commercialization of CDP-enriched functional foods and therapeutics.
Author Contributions
Conceptualization, A.L., T.M. and I.S.; methodology, T.M.; validation, I.S. and A.L.; resources, L.P.; data curation, A.L. and T.M.; writing—original draft preparation, A.L. and T.M.; writing—review and editing, A.L., I.S. and T.M.; supervision, A.L.; project administration, L.P.; funding acquisition, L.P. All authors have read and agreed to the published version of the manuscript.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
Not applicable.
Conflicts of Interest
The authors declare no conflict of interest.
Funding Statement
This work was funded by a grant by the Research in Veterinary Medicine Unit (I-MVET), of the Faculty of Veterinary Medicine, Lusófona University.
Footnotes
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
References
- 1.Runthala A., Mbye M., Ayyash M., Xu Y., Kamal-Eldin A. Caseins: Versatility of Their Micellar Organization in Relation to the Functional and Nutritional Properties of Milk. Molecules. 2023;28:2023. doi: 10.3390/molecules28052023. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Auestad N., Layman D.K. Dairy bioactive proteins and peptides: A narrative review. Nutr. Rev. 2021;79:36–47. doi: 10.1093/nutrit/nuab097. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Kim J. Pre-sleep casein protein ingestion: New paradigm in post-exercise recovery nutrition. Phys. Act. Nutr. 2020;24:6–10. doi: 10.20463/pan.2020.0009. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Leng J., Jiang Y., Zhou T., Zhang S., Zhu C., Wang B., Li L., Zhao W. Unveiling the slow digestion and peptide profiles of polymerised whey gel via heat and TGase crosslinking: An in vitro/vivo perspective. Food Chem. 2025;464:141829. doi: 10.1016/j.foodchem.2024.141829. [DOI] [PubMed] [Google Scholar]
- 5.Jiménez-Barrios P., Sánchez-Rivera L., Martínez-Maqueda D., Gouar Y.L., Dupont D., Miralles B., Recio I. Peptidomic Characterization and Amino Acid Availability after Intake of Casein vs. a Casein Hydrolysate in a Pig Model. Nutrients. 2023;15:1065. doi: 10.3390/nu15051065. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Treweek T. Alpha-Casein as a Molecular Chaperone. In: Walter L., Hurley W.L., editors. Milk Protein. InTech; Rijeka, Croatia: 2012. pp. 85–118. [DOI] [Google Scholar]
- 7.Gebhardt R., Hohn C., Asaduzzaman M. Stabilizing interactions of casein microparticles after a thermal post-treatment. Food Chem. 2024;450:139369. doi: 10.1016/j.foodchem.2024.139369. [DOI] [PubMed] [Google Scholar]
- 8.Mohanty D., Jena R., Choudhury P.K., Pattnaik R., Mohapatra S., Saini M.R. Milk derived antimicrobial bioactive peptides: A review. Int. J. Food Prop. 2016;19:837–846. doi: 10.1080/10942912.2015.1048356. [DOI] [Google Scholar]
- 9.Hou J., Liu Z., Cao S., Wang H., Jiang C., Hussain M.A., Pang S. Broad-Spectrum antimicrobial activity and low cytotoxicity against human cells of a peptide derived from bovine αS1-casein. Molecules. 2018;23:1220. doi: 10.3390/molecules23051220. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Daliri E.B.-M., Oh D.H., Lee B.H. Bioactive peptides. Foods. 2017;6:32. doi: 10.3390/foods6050032. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Aslam B., Khurshid M., Arshad M.I., Muzammil S., Rasool M., Yasmeen N., Shah T., Chaudhry T.H., Rasool M.H., Shahid A., et al. Antibiotic Resistance: One Health One World Outlook. Front. Cell. Infect. Microbiol. 2021;11:771510. doi: 10.3389/fcimb.2021.771510. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Ji S., An F., Zhang T., Lou M., Guo J., Liu K., Zhu Y., Wu J., Wu R. Antimicrobial peptides: An alternative to traditional antibiotics. Eur. J. Med. Chem. 2024;265:116072. doi: 10.1016/j.ejmech.2023.116072. [DOI] [PubMed] [Google Scholar]
- 13.Luo Y., Song Y. Mechanism of antimicrobial peptides: Antimicrobial, anti-inflammatory and antibiofilm activities. Int. J. Mol. Sci. 2021;22:11401. doi: 10.3390/ijms222111401. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Zhang Q.Y., Yan Z.-B., Meng Y.-M., Hong X.-Y., Shao G., Ma J.-J., Cheng X.-R., Liu J., Kang J., Fu C.-Y. Antimicrobial peptides: Mechanism of action, activity and clinical potential. Mil. Med. Res. 2021;8:48. doi: 10.1186/s40779-021-00343-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Wang S., Zeng X., Yang Q., Qiao S. Antimicrobial peptides as potential alternatives to antibiotics in food animal industry. Int. J. Mol. Sci. 2016;17:603. doi: 10.3390/ijms17050603. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Chakrabarti S., Guha S., Majumder K. Food-derived bioactive peptides in human health: Challenges and opportunities. Nutrients. 2018;10:1738. doi: 10.3390/nu10111738. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Kim W., Wang Y., Selomulya C. Dairy and plant proteins as natural food emulsifiers. Trends Food Sci. Technol. 2020;105:261–272. doi: 10.1016/j.tifs.2020.09.012. [DOI] [Google Scholar]
- 18.Singh R.K., Kumar D.P., Solanki M.K., Singh P., Srivastva A.K., Kumar S., Kashyap P.L., Saxena A.K., Singhal P.K., Arora D.K. Optimization of media components for chitinase production by chickpea rhizosphere associated Lysinibacillus fusiformis B-CM18. J. Basic Microbiol. 2013;53:451–460. doi: 10.1002/jobm.201100590. [DOI] [PubMed] [Google Scholar]
- 19.Ranadheera C.S., Liyanaarachchi W.S., Chandrapala J., Dissanayake M., Vasiljevic T. Utilizing unique properties of caseins and the casein micelle for delivery of sensitive food ingredients and bioactives. Trends Food Sci. Technol. 2016;57:178–187. doi: 10.1016/j.tifs.2016.10.005. [DOI] [Google Scholar]
- 20.Głąb T.K., Boratyński J. Potential of Casein as a Carrier for Biologically Active Agents. Top. Curr. Chem. 2017;375:71. doi: 10.1007/s41061-017-0158-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Nourmohammadi E., Mahoonak A.S. Health Implications of Bioactive Peptides: A Review. Int. J. Vitam. Nutr. Res. 2018;88:319–340. doi: 10.1024/0300-9831/a000418. [DOI] [PubMed] [Google Scholar]
- 22.Petrova S.Y., Khlgatian S.V., Emelyanova O.Y., Pishulina L.A., Berzhets V.M. Structure and biological functions of milk caseins. Russ. Open Med. J. 2022;11:e0209. doi: 10.15275/rusomj.2022.0209. [DOI] [Google Scholar]
- 23.Singh A., Duche R.T., Wandhare A.G., Sian J.K., Singh B.P., Sihag M.K., Singh K.S., Sangwan V., Talan S., Panwar H. Milk-Derived Antimicrobial Peptides: Overview, Applications, and Future Perspectives. Probiotics Antimicrob. Proteins. 2022;15:44–62. doi: 10.1007/s12602-022-10004-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Foroutan A., Guo A.C., Vazquez-Fresno R., Lipfert M., Zhang L., Zheng J., Badran H., Budinski Z., Mandal R., Ametaj B.N., et al. Chemical Composition of Commercial Cow’s Milk. J. Agric. Food Chem. 2019;67:4897–4914. doi: 10.1021/acs.jafc.9b00204. [DOI] [PubMed] [Google Scholar]
- 25.Guha S., Sharma H., Deshwal G.K., Rao P.S. A comprehensive review on bioactive peptides derived from milk and milk products of minor dairy species. Food Prod. Process Nutr. 2021;3:2. doi: 10.1186/s43014-020-00045-7. [DOI] [Google Scholar]
- 26.Holt C. Casein and casein micelle structures, functions and diversity in 20 species. Int. Dairy J. 2016;60:2–13. doi: 10.1016/j.idairyj.2016.01.004. [DOI] [Google Scholar]
- 27.Huppertz T., Fox P.F., Kelly A.L. The caseins: Structure, stability, and functionality. In: Yada R.Y., editor. Proteins in Food Processing. 2nd ed. Elsevier; Amsterdam, The Netherlands: 2018. pp. 49–92. [DOI] [Google Scholar]
- 28.De Kruif C.G., Holt C. Casein Micelle Structure, Functions and Interactions. In: Fox P.F., McSweeney P.L.H., editors. Advanced Dairy Chemistry—1 Proteins. 3rd ed. Springer Science + Business Media; New York, NY, USA: 2003. pp. 233–276. [DOI] [Google Scholar]
- 29.Kalyankar S.D., Khedkar C.D., Patil A.M., Deosarkar S.S. Milk: Sources and Composition. In: Caballero B., Finglas P., Toldra F., editors. Encyclopedia of Food and Health. Elsevier; Amsterdam, The Netherlands: 2016. pp. 741–747. [DOI] [Google Scholar]
- 30.The UniProt Consortium, UniProt: The Universal Protein Knowledgebase in 2025. Nucleic Acids Res. 2025;53:D609–D617. doi: 10.1093/nar/gkae1010. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Minkiewicz P., Iwaniak A., Darewicz M. BIOPEP-UWM Database of Bioactive Peptides: Current Opportunities. Int. J. Mol. Sci. 2019;20:5978. doi: 10.3390/ijms20235978. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Moller T.L., Nielsen S.B., Corredig M. Novel details on the dissociation of casein micelle suspensions as a function of pH and temperature. J. Dairy Sci. 2023;106:8368–8374. doi: 10.3168/jds.2023-23456. [DOI] [PubMed] [Google Scholar]
- 33.Atamer Z., Post A.E., Schubert T., Holder A., Boom R.M., Hinrichs J. Bovine β-casein: Isolation, properties and functionality. A review. Int. Dairy J. 2016;66:115–125. doi: 10.1016/j.idairyj.2016.11.010. [DOI] [Google Scholar]
- 34.Fitzgerald R.J., Murray B.A. Bioactive Peptides and Lactic Fermentations. Int. J. Dairy Technol. 2006;59:118–125. doi: 10.1111/j.1471-0307.2006.00250.x. [DOI] [Google Scholar]
- 35.McCarthy R., Mills S., Ross R., Fitzgerald G., Stanton C. Bioactive Peptides from Casein and Whey Proteins. In: Kanekanian A., editor. Milk and Dairy Products as Functional Foods. Wiley Blackwell; Oxford, UK: 2014. pp. 23–54. [DOI] [Google Scholar]
- 36.Nielsen S.D.H., Liang N., Rathish H., Kim B.J., Lueangsakulthai J., Koh J., Qu Y., Schulz H.J., Dallas D.C. Bioactive milk peptides: An updated comprehensive overview and database. Crit. Rev. Food Sci. Nutr. 2023;64:11510–11529. doi: 10.1080/10408398.2023.2240396. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Phelan M., Aherne A., FitzGerald R.J., O’Brien N.M. Casein-derived bioactive peptides: Biological effects, industrial uses, safety aspects and regulatory status. Int. Dairy J. 2009;19:643–654. doi: 10.1016/j.idairyj.2009.06.001. [DOI] [Google Scholar]
- 38.Zhou S., Xu T., Zhang X., Luo J., An P., Luo Y. Effect of casein hydrolysate on Cardiovascular Risk Factors: A Systematic Review and Meta-Analysis of Randomized Controlled Trials. Nutrients. 2022;14:4207. doi: 10.3390/nu14194207. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.De Vasconcelos M.L., Oliveira L.M.F.S., Hill J.P., Vidal A.M.C. Difficulties in Establishing the Adverse Effects of β-Casomorphin-7 Released from β-Casein Variants—A Review. Foods. 2023;12:3151. doi: 10.3390/foods12173151. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Liu H., Zhang L., Yu J., Shao S. Advances in the application and mechanism of bioactive peptides in the treatment of inflammation. Front. Immunol. 2024;15:1413179. doi: 10.3389/fimmu.2024.1413179. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Meisel H. Biochemical properties of peptides encrypted in bovine milk proteins. Curr. Med. Chem. 2005;12:1905–1919. doi: 10.2174/0929867054546618. [DOI] [PubMed] [Google Scholar]
- 42.Teschemacher H. Opioid receptor ligands derived from food proteins. Curr. Pharm. Des. 2003;9:1331–1344. doi: 10.2174/1381612033454856. [DOI] [PubMed] [Google Scholar]
- 43.Nakamura Y., Yamamoto N., Sakai K., Okubo A., Yamazaki S., Takano T. Purification and characterization of angiotensin-converting enzyme inhibitors from sour milk. J. Dairy Sci. 1995;78:777–783. doi: 10.3168/jds.S0022-0302(95)76689-9. [DOI] [PubMed] [Google Scholar]
- 44.Yamamoto N., Takano T. Antihypertensive peptides derived from milk proteins. Food/Nahrung. 1999;43:159–164. doi: 10.1002/(SICI)1521-3803(19990601)43:3<159::AID-FOOD159>3.0.CO;2-R. [DOI] [PubMed] [Google Scholar]
- 45.Pellegrini A. Antimicrobial Peptides from Food Proteins. Curr. Pharm. Des. 2003;9:1225–1238. doi: 10.2174/1381612033454865. [DOI] [PubMed] [Google Scholar]
- 46.McCann K., Shiell B., Michalski W., Lee A., Wan J., Roginski H., Coventry M. Isolation and characterisation of antibacterial peptides derived from the f(164-207) region of bovine αS2-casein. Int. Dairy J. 2005;15:133–143. doi: 10.1016/j.idairyj.2004.06.008. [DOI] [Google Scholar]
- 47.Benoit S., Chaumontet C., Violle N., Boulier A., Hafeez Z., Cakir-Kiefer C., Tomé D., Schwarz J., Miclo L. The Anxiolytic-like Properties of a Tryptic Hydrolysate of Bovine αs1 Casein Containing α-Casozepine Rely on GABAA Receptor Benzodiazepine Binding Sites but Not the Vagus Nerve. Nutrients. 2022;14:2212. doi: 10.3390/nu14112212. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Freret T., Largilliere S., Née G., Coolzaet M., Corvaisier S., Boulouard M. Fast Anxiolytic-Like Effect Observed in the Rat Conditioned Defensive Burying Test, after a Single Oral Dose of Natural Protein Extract Products. Nutrients. 2021;13:2445. doi: 10.3390/nu13072445. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Sah B.N.P., Vasiljevic T., McKechnie S., Donkor O.N. Antioxidative and antibacterial peptides derived from bovine milk proteins. Crit. Rev. Food Sci. Nutr. 2016;58:726–740. doi: 10.1080/10408398.2016.1217825. [DOI] [PubMed] [Google Scholar]
- 50.Abril A.G., Pazos M., Villa T.G., Calo-Mata P., Barros-Velázquez J., Carrera M. Proteomics Characterization of Food-Derived Bioactive Peptides with Anti-Allergic and Anti-Inflammatory Properties. Nutrients. 2022;14:4400. doi: 10.3390/nu14204400. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Korhonen H., Pihlanto A. Bioactive peptides: Production and functionality. Int. Dairy J. 2006;16:945–960. doi: 10.1016/j.idairyj.2005.10.012. [DOI] [Google Scholar]
- 52.Bamdad F., Bark S., Kwon C.H., Suh J.W., Sunwoo H. Anti-inflammatory and antioxidant properties of peptides released from β-lactoglobulin by high hydrostatic pressure-assisted enzymatic hydrolysis. Molecules. 2017;22:949. doi: 10.3390/molecules22060949. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Liu M., Khani A., Eghbalpour S., Uversky V.N. Bioactive Peptides: Synthesis, Sources, Applications, and Proposed Mechanisms of Action. Int. J. Mol. Sci. 2022;23:1445. doi: 10.3390/ijms23031445. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Zambrowicz A., Timmer M., Polanowski A., Lubec G., Trziszka T. Manufacturing of peptides exhibiting biological activity. Amino Acids. 2013;44:315–320. doi: 10.1007/s00726-012-1379-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55.Santos I., Silva M., Grácio M., Pedroso L., Lima A. Milk Antiviral Proteins and Derived Peptides against Zoonoses. Int. J. Mol. Sci. 2024;25:1842. doi: 10.3390/ijms25031842. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Hwanhlem N., Buradaleng S., Wattanachant S., Benjakul S., Tani A., Maneerat S. Isolation and screening of lactic acid bacteria from Thai traditional fermented fish (Plasom) and production of Plasom from selected strains. Food Control. 2011;22:401–407. doi: 10.1016/j.foodcont.2010.09.010. [DOI] [Google Scholar]
- 57.Abdul Hakim B.N., Xuan N.J., Oslan S.N.H. A Comprehensive Review of Bioactive Compounds from Lactic Acid Bacteria: Potential Functions as Functional Food in Dietetics and the Food Industry. Foods. 2023;12:2850. doi: 10.3390/foods12152850. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Mokoena M.P. Lactic acid bacteria and their bacteriocins: Classification, biosynthesis and applications against uropathogens: A mini–review. Molecules. 2017;22:1255. doi: 10.3390/molecules22081255. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Wang C., Chang T., Yang H., Cui M. Antibacterial mechanism of lactic acid on physiological and morphological properties of Salmonella Enteritidis, Escherichia coli and Listeria monocytogenes. Food Control. 2015;47:231–236. doi: 10.1016/j.foodcont.2014.06.034. [DOI] [Google Scholar]
- 60.Ulug S.K., Jahandideh F., Wu J. Novel technologies for the production of bioactive peptides. Trends Food Sci. Technol. 2020;108:27–39. doi: 10.1016/j.tifs.2020.12.002. [DOI] [Google Scholar]
- 61.Dong X., Li J., Jiang G., Li H., Zhao M., Jiang Y. Effects of combined high pressure and enzymatic treatments on physicochemical and antioxidant properties of peanut proteins. Food Sci. Nutr. 2019;7:1417–1425. doi: 10.1002/fsn3.976. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Ketnawa S., Wickramathilaka M., Liceaga A.M. Changes on antioxidant activity of microwave-treated protein hydrolysates after simulated gastrointestinal digestion: Purification and identification. Food Chem. 2018;254:36–46. doi: 10.1016/j.foodchem.2018.01.133. [DOI] [PubMed] [Google Scholar]
- 63.Dallas D.C., Citerne F., Tian T., Silva V.L., Kalanetra K.M., Frese S.A., Robinson R.C., Mills D.A., Barile D. Peptidomic analysis reveals proteolytic activity of kefir microorganisms on bovine milk proteins. Food Chem. 2015;197:273–284. doi: 10.1016/j.foodchem.2015.10.116. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Miclo L., Roux É., Genay M., Brusseaux É., Poirson C., Jameh N., Perrin C., Dary A. Variability of Hydrolysis of β-, αs1- and αs2-Caseins by 10 Strains of Streptococcus thermophilus and Resulting Bioactive Peptides. J. Agric. Food Chem. 2011;60:554–565. doi: 10.1021/jf202176d. [DOI] [PubMed] [Google Scholar]
- 65.Sforza S., Cavatorta V., Lambertini F., Galaverna G., Dossena A., Marchelli R. Cheese peptidomics: A detailed study on the evolution of the oligopeptide fraction in Parmigiano-Reggiano cheese from curd to 24 months of aging. J. Dairy Sci. 2012;95:3514–3526. doi: 10.3168/jds.2011-5046. [DOI] [PubMed] [Google Scholar]
- 66.Gupta A., Mann B., Kumar R., Sangwan R.B. Identification of antioxidant peptides in cheddar cheese made with adjunct culture Lactobacillus casei ssp. casei 300. [(accessed on 18 February 2025)];Milchwissenschaft. 2010 65:396–399. Available online: https://www.cabdirect.org/cabdirect/abstract/20103340704. [Google Scholar]
- 67.Toelstede S., Hofmann T. Sensomics mapping and identification of the key bitter metabolites in gouda cheese. J. Agric. Food Chem. 2008;56:2795–2804. doi: 10.1021/jf7036533. [DOI] [PubMed] [Google Scholar]
- 68.Combes C., Paterson E., Amadò R. Isolation and Identification of Low-Molecular-Weight Peptides from Emmentaler Cheese. J. Food Sci. 2002;67:553–559. doi: 10.1111/j.1365-2621.2002.tb10637.x. [DOI] [Google Scholar]
- 69.Mora L., Gallego M., Toldrá F. New approaches based on comparative proteomics for the assessment of food quality. Curr. Opin. Food Sci. 2018;22:22–27. doi: 10.1016/j.cofs.2018.01.005. [DOI] [Google Scholar]
- 70.Niaz B., Saeed F., Ahmed A., Imran M., Maan A.A., Khan M.K.I., Tufail T., Anjum F.M., Hussain S., Suleria H.A.R. Lactoferrin (LF): A natural antimicrobial protein. Int. J. Food Prop. 2019;22:1626–1641. doi: 10.1080/10942912.2019.1666137. [DOI] [Google Scholar]
- 71.Khan M.U., Pirzadeh M., Förster C.Y., Shityakov S., Shariati M.A. Role of milk-derived antibacterial peptides in modern food biotechnology: Their synthesis, applications and future perspectives. Biomolecules. 2018;8:110. doi: 10.3390/biom8040110. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72.Nibbering P.H., Ravensbergen E., Welling M.M., Van Berkel L.A., Van Berkel P.H.C., Pauwels E.K.J., Nuijens J.H. Human lactoferrin and peptides derived from its N terminus are highly effective against infections with antibiotic-resistant bacteria. Infect. Immun. 2001;69:1469–1476. doi: 10.1128/IAI.69.3.1469-1476.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 73.Brück W.M., Kelleher L., Gibson G.R., Nielsen E.K., Chatterton E.W.D., Lönnerdal B. rRNA Probes Used to Quantify the Effects of Glycomacropeptide and-Lactalbumin Supplementation on the Predominant Groups of Intestinal Bacteria of Infant Rhesus Monkeys Challenged with Enteropathogenic Escherichia coli. J. Pediatr. Gastroenterol. Nutr. 2003;37:273–280. doi: 10.1097/00005176-200309000-00014. [DOI] [PubMed] [Google Scholar]
- 74.Wang X., Sun Y., Wang F., You L., Cao Y., Tang R., Wen J., Cui X. A novel endogenous antimicrobial peptide CAMP211-225 derived from casein in human milk. Food Funct. 2020;11:2291–2298. doi: 10.1039/C9FO02813G. [DOI] [PubMed] [Google Scholar]
- 75.Liu Y., Eichler J., Pischetsrieder M. Virtual screening of a milk peptide database for the identification of food-derived antimicrobial peptides. Mol. Nutr. Food Res. 2015;59:2243–2254. doi: 10.1002/mnfr.201500182. [DOI] [PubMed] [Google Scholar]
- 76.Hayes M., Ross R.P., Fitzgerald G.F., Hill C., Stanton C. Casein-Derived Antimicrobial Peptides Generated by Lactobacillus acidophilus DPC6026. Appl. Environ. Microbiol. 2006;72:2260–2264. doi: 10.1128/AEM.72.3.2260-2264.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 77.Kent R., Guinane C., O’Connor P., Fitzgerald G., Hill C., Stanton C., Ross R. Production of the antimicrobial peptides Caseicin A and B by Bacillus isolates growing on sodium caseinate. Lett. Appl. Microbiol. 2012;55:141–148. doi: 10.1111/j.1472-765X.2012.03271.x. [DOI] [PubMed] [Google Scholar]
- 78.Norberg S., O’Connor P.M., Stanton C., Ross R.P., Hill C., Fitzgerald G.F., Cotter P.D. Extensive manipulation of caseicins A and B highlights the tolerance of these antimicrobial peptides to change. Appl. Environ. Microbiol. 2012;78:2353–2358. doi: 10.1128/AEM.07312-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79.McClean S., Beggs L.B., Welch R.W. Antimicrobial activity of antihypertensive food-derived peptides and selected alanine analogues. Food Chem. 2013;146:443–447. doi: 10.1016/j.foodchem.2013.09.094. [DOI] [PubMed] [Google Scholar]
- 80.Lahov E., Regelson W. Antibacterial and immunostimulating casein-derived substances from milk: Casecidin, isracidin peptides. Food Chem. Toxicol. 1996;34:131–145. doi: 10.1016/0278-6915(95)00097-6. [DOI] [PubMed] [Google Scholar]
- 81.Birkemo G., O’Sullivan O., Ross R., Hill C. Antimicrobial activity of two peptides casecidin 15 and 17, found naturally in bovine colostrum. J. Appl. Microbiol. 2008;106:233–240. doi: 10.1111/j.1365-2672.2008.03996.x. [DOI] [PubMed] [Google Scholar]
- 82.Rizzello C., Losito I., Gobbetti M., Carbonara T., De Bari M., Zambonin P. Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian Cheese Varieties. J. Dairy Sci. 2005;88:2348–2360. doi: 10.3168/jds.S0022-0302(05)72913-1. [DOI] [PubMed] [Google Scholar]
- 83.McCann K., Shiell B., Michalski W., Lee A., Wan J., Roginski H., Coventry M. Isolation and characterisation of a novel antibacterial peptide from bovine αS1-casein. Int. Dairy J. 2005;16:316–323. doi: 10.1016/j.idairyj.2005.05.005. [DOI] [Google Scholar]
- 84.Tang W., Yuan H., Zhang H., Wang L., Qian H., Qi X. An antimicrobial peptide screened from casein hydrolyzate by Saccharomyces cerevisiae cell membrane affinity method. Food Control. 2014;50:413–422. doi: 10.1016/j.foodcont.2014.09.030. [DOI] [Google Scholar]
- 85.Elbarbary H.A., Abdou A.M., Nakamura Y., Park E.Y., Mohamed H.A., Sato K. Identification of novel antibacterial peptides isolated from a commercially available casein hydrolysate by autofocusing technique. BioFactors. 2012;38:309–315. doi: 10.1002/biof.1023. [DOI] [PubMed] [Google Scholar]
- 86.López-Expósito I., Gómez-Ruiz J.Á., Amigo L., Recio I. Identification of antibacterial peptides from ovine αs2-casein. Int. Dairy J. 2006;16:1072–1080. doi: 10.1016/j.idairyj.2005.10.006. [DOI] [Google Scholar]
- 87.Alvarez-Ordóñez A., Begley M., Clifford T., Deasy T., Considine K., Hill C. Structure-Activity Relationship of Synthetic Variants of the Milk-Derived Antimicrobial Peptide α s2 -Casein f(183–207) Appl. Environ. Microbiol. 2013;79:5179–5185. doi: 10.1128/AEM.01394-13. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 88.Recio I., Visser S. Identification of two distinct antibacterial domains within the sequence of bovine αs2-casein. Biochim. Biophys. Acta Gen. Subj. 1999;1428:314–326. doi: 10.1016/S0304-4165(99)00079-3. [DOI] [PubMed] [Google Scholar]
- 89.López-Expósito I., Amigo L., Recio I. Identification of the initial binding sites of αs2-casein f(183–207) and effect on bacterial membranes and cell morphology. Biochim. Biophys. Acta Biomembr. 2008;1778:2444–2449. doi: 10.1016/j.bbamem.2008.06.018. [DOI] [PubMed] [Google Scholar]
- 90.López-Expósito I., Pellegrini A., Amigo L., Recio I. Synergistic effect between different Milk-Derived peptides and proteins. Int. Dairy J. 2008;91:2184–2189. doi: 10.3168/jds.2007-0037. [DOI] [PubMed] [Google Scholar]
- 91.Sistla S. Structure–activity relationships of αs-casein peptides with multifunctional biological activities. Mol. Cell. Biochem. 2013;384:29–38. doi: 10.1007/s11010-013-1778-4. [DOI] [PubMed] [Google Scholar]
- 92.Zucht H., Raida M., Adermann K., Mägert H., Forssmann W. Casocidin-I: A casein-αs2 derived peptide exhibits antibacterial activity. FEBS Lett. 1995;372:185–188. doi: 10.1016/0014-5793(95)00974-E. [DOI] [PubMed] [Google Scholar]
- 93.Bougherra F., Dilmi-Bouras A., Balti R., Przybylski R., Adoui F., Elhameur H., Chevalier M., Flahaut C., Dhulster P., Naima N. Antibacterial activity of new peptide from bovine casein hydrolyzed by a serine metalloprotease of Lactococcus lactis subsp lactis BR16. J. Funct. Foods. 2017;32:112–122. doi: 10.1016/j.jff.2017.02.026. [DOI] [Google Scholar]
- 94.Liu Y., Ma Y., Hou C., Song S. Inhibitory effect of milk-derived peptide αS2-casein151-181 against spore-forming bacteria. Int. Dairy J. 2020;104:104651. doi: 10.1016/j.idairyj.2020.104651. [DOI] [Google Scholar]
- 95.Ouertani A., Chaabouni I., Mosbah A., Long J., Barakat M., Mansuelle P., Mghirbi O., Najjari A., Ouzari H., Masmoudi A.S., et al. Two New Secreted Proteases Generate a Casein-Derived Antimicrobial Peptide in Bacillus cereus Food Born Isolate Leading to Bacterial Competition in Milk. Front. Microbiol. 2018;9:1148. doi: 10.3389/fmicb.2018.01148. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 96.Sedaghati M., Ezzatpanah H., Boojar M.M.A., Ebrahimi M.T., Kobarfard F. Isolation and identification of some antibacterial peptides in the plasmin-digest of β-casein. LWT. 2015;68:217–225. doi: 10.1016/j.lwt.2015.12.019. [DOI] [Google Scholar]
- 97.López-Expósito I., Minervini F., Amigo L., Recio I. Identification of Antibacterial Peptides from Bovine κ-Casein. J. Food Prot. 2006;69:2992–2997. doi: 10.4315/0362-028X-69.12.2992. [DOI] [PubMed] [Google Scholar]
- 98.Pellegrini A., Dettling C., Thomas U., Hunziker P. Isolation and characterization of four bactericidal domains in the bovine β-lactoglobulin. Biochim. Biophys. Acta Gen. Subj. 2001;1526:131–140. doi: 10.1016/S0304-4165(01)00116-7. [DOI] [PubMed] [Google Scholar]
- 99.Sedaghati M., Ezzatpanah H., Boojar M.M., Ebrahimi M.T., Aminafshar M. Plasmin-digest of β-lactoglobulin with antibacterial properties. Food Agric. Immunol. 2014;26:218–230. doi: 10.1080/09540105.2014.893998. [DOI] [Google Scholar]
- 100.Demers-Mathieu V., Gauthier S.F., Britten M., Fliss I., Robitaille G., Jean J. Antibacterial activity of peptides extracted from tryptic hydrolyzate of whey protein by nanofiltration. Int. Dairy J. 2012;28:94–101. doi: 10.1016/j.idairyj.2012.09.003. [DOI] [Google Scholar]
- 101.Théolier J., Hammami R., Labelle P., Fliss I., Jean J. Isolation and identification of antimicrobial peptides derived by peptic cleavage of whey protein isolate. J. Funct. Foods. 2013;5:706–714. doi: 10.1016/j.jff.2013.01.014. [DOI] [Google Scholar]
- 102.Liu V., Dashper S., Parashos P., Liu S., Stanton D., Shen P., Chivatxaranukul P., Reynolds E. Antibacterial efficacy of casein-derived peptides against Enterococcus faecalis. Aust. Dent. J. 2012;57:339–343. doi: 10.1111/j.1834-7819.2012.01711.x. [DOI] [PubMed] [Google Scholar]
- 103.Malkoski M., Dashper S.G., O’Brien-Simpson N.M., Talbo G.H., Macris M., Cross K.J., Reynolds E.C. Kappacin, a Novel Antibacterial Peptide from Bovine Milk. Antimicrob. Agents Chemother. 2001;45:2309–2315. doi: 10.1128/AAC.45.8.2309-2315.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 104.Sedaghati M., Ezzatpanah H., Boojar M.M.A., Ebrahimi M.T., Aminafshar M. Plasmin digest of κ-casein as a source of antibacterial peptides. J. Dairy Res. 2014;81:245–251. doi: 10.1017/S0022029914000120. [DOI] [PubMed] [Google Scholar]
- 105.Robitaille G., Lapointe C., Leclerc D., Britten M. Effect of pepsin-treated bovine and goat caseinomacropeptide on Escherichia coli and Lactobacillus rhamnosus in acidic conditions. J. Dairy Sci. 2011;95:1–8. doi: 10.3168/jds.2010-4142. [DOI] [PubMed] [Google Scholar]
- 106.Popa G.L., Papa M.I. Salmonella spp. Infection—A continuous threat worldwide. Germs. 2021;15:88–96. doi: 10.18683/germs.2021.1244. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 107.Disson O., Moura A., Lecuit M. Making Sense of the Biodiversity and Virulence of Listeria monocytogenes. Trends Microbiol. 2021;29:811–822. doi: 10.1016/j.tim.2021.01.008. [DOI] [PubMed] [Google Scholar]
- 108.Gambushe S.M., Zishiri O.T., Zowalaty M.E. Review of Escherichia coli O157:H7 Prevalence, Pathogenicity, Heavy Metal and Antimicrobial Resistance, African Perspective. Infect. Drug Resist. 2022;15:4645–4673. doi: 10.2147/IDR.S365269. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 109.Romano A., Carrella S., Rezza S., Nia Y., Hennekinne J., Bianchi D., Martucci F., Zuccon F., Gulino M., Mari C., et al. First report of food poisoning due to staphylococcal enterotoxin type B in döner kebab (Italy) Pathogens. 2023;12:1139. doi: 10.3390/pathogens12091139. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 110.Yang K., Shi Y., Li Y., Wei G., Zhao Q., Huang A. iTRAQ-based quantitative proteomic analysis of antibacterial mechanism of milk-derived peptide BCp12 against Escherichia coli. Foods. 2022;11:672. doi: 10.3390/foods11050672. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 111.Qi S., Zhao S., Zhang H., Liu S., Liu J., Yang J., Qi Y., Zhao Q., Jin Y., Wang F. Novel casein antimicrobial peptides for the inhibition of oral pathogenic bacteria. Food Chem. 2023;425:136454. doi: 10.1016/j.foodchem.2023.136454. [DOI] [PubMed] [Google Scholar]
- 112.Sansi M.S., Iram D., Zanab S., Vij S., Puniya A.K., Singh A., Ashutosh, Meena S. Antimicrobial bioactive peptides from goat Milk proteins: In silico prediction and analysis. J. Food Biochem. 2022;46:14311. doi: 10.1111/jfbc.14311. [DOI] [PubMed] [Google Scholar]
- 113.Tomazou M., Oulas A., Anagnostopoulos A.K., Tsangaris G.T., Spyrou G.M. In Silico Identification of Antimicrobial Peptides in the Proteomes of Goat and Sheep Milk and Feta Cheese. Proteomes. 2019;7:32. doi: 10.3390/proteomes7040032. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 114.Tu M., Liu H., Zhang R., Chen H., Fan F., Shi P., Xu X., Lu W., Du M. Bioactive hydrolysates from casein: Generation, identification, and in silico toxicity and allergenicity prediction of peptides. J. Sci. Food Agric. 2017;98:3416–3426. doi: 10.1002/jsfa.8854. [DOI] [PubMed] [Google Scholar]
- 115.Corrêa J.A.F., Evangelista A.G., Nazareth T.M., Luciano F.B. Fundamentals on the molecular mechanism of action of antimicrobial peptides. Acta Mater. 2019;8:100494. doi: 10.1016/j.mtla.2019.100494. [DOI] [Google Scholar]
- 116.Saubenova M., Oleinikova Y., Rapoport A., Maksimovich S., Yermekbay Z., Khamedova E. Bioactive peptides derived from whey proteins for health and functional beverages. Fermentation. 2024;10:359. doi: 10.3390/fermentation10070359. [DOI] [Google Scholar]
- 117.Łojewska E., Sakowicz T. An alternative to antibiotics: Selected methods to combat zoonotic foodborne bacterial infections. Curr. Microbiol. 2021;78:4037–4049. doi: 10.1007/s00284-021-02665-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 118.Liu Z., Brady A., Young A., Rasimick B., Chen K., Zhou C., Kallenbach N. Length effects in antimicrobial peptides of the (RW)n series. Antimicrob. Agents Chemother. 2007;51:597–603. doi: 10.1128/AAC.00828-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 119.Bin Hafeez A., Jiang X., Bergen P.J., Zhu Y. Antimicrobial peptides: An update on classifications and databases. Int. J. Mol. Sci. 2021;22:11691. doi: 10.3390/ijms222111691. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 120.Sun Y., Zhou Y., Liu X., Zhang F., Yan L., Chen L., Wang X., Ruan H., Ji C., Cui X., et al. Antimicrobial activity and mechanism of PDC213, an endogenous peptide from human milk. Biochem. Biophys. Res. Commun. 2017;484:132–137. doi: 10.1016/j.bbrc.2017.01.059. [DOI] [PubMed] [Google Scholar]
- 121.Zhang X., Yang J., Suo H., Tan J., Zhang Y., Song J. Identification and molecular mechanism of action of antibacterial peptides from Flavourzyme-hydrolyzed yak casein against Staphylococcus aureus. J. Dairy Sci. 2023;106:3779–3790. doi: 10.3168/jds.2022-22823. [DOI] [PubMed] [Google Scholar]
- 122.Talapko J., Meštrović T., Juzbašić M., Tomas M., Erić S., Aleksijević L., Bekić S., Schwarz D., Matić S., Neuberg M., et al. Antimicrobial peptides—Mechanisms of action, antimicrobial effects and clinical applications. Antibiotics. 2022;11:1417. doi: 10.3390/antibiotics11101417. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 123.He J., Li H., Xu Y., Li Y., Yang T., Yu X., Yang X., Huang A., Yu Y., Shi Y. Milk-derived antimicrobial peptide GMp7: Disrupting protein networks for multi-target antibacterial inhibition and enhanced dairy preservation. J. Dairy Sci. 2025;108:3428–3443. doi: 10.3168/jds.2024-26090. [DOI] [PubMed] [Google Scholar]
- 124.Amiri E.O., Farmani J., Amiri Z.R., Dehestani A., Mohseni M. Antimicrobial activity, environmental sensitivity, mechanism of action, and food application of αs165-181 peptide. Int. J. Food Microbiol. 2021;358:109403. doi: 10.1016/j.ijfoodmicro.2021.109403. [DOI] [PubMed] [Google Scholar]
- 125.Mudgil P., AlMazroui M., Redha A.A., Kilari B.P., Srikumar S., Maqsood S. Cow and camel milk-derived whey and casein protein hydrolysates demonstrated effective antifungal properties against selected Candida species. J. Dairy Sci. 2021;105:1878–1888. doi: 10.3168/jds.2021-20944. [DOI] [PubMed] [Google Scholar]
- 126.Ningsih D.R., Raharjo T.J., Haryadi W., Wikandari R. Antifungal activity and identification of bioactive peptide from Etawa crossbreed goat (Capra hircus) milk protein hydrolyzed using trypsin enzyme. Arab. J. Chem. 2023;16:105249. doi: 10.1016/j.arabjc.2023.105249. [DOI] [Google Scholar]
- 127.Qu H., Wang Y., Kang J., Yao Q., Dong A., Liu Y. Reuse of waste casein peptides to capture Cu (II) for long-term antibacterial reutilization. Colloid Interface Sci. Commun. 2024;60:100781. doi: 10.1016/j.colcom.2024.100781. [DOI] [Google Scholar]
- 128.Blondelle S.E., Lohner K. Combinatorial libraries: A tool to design antimicrobial and antifungal peptide analogues having lytic specificities for structure-activity relationship studies. Biopolymers. 2000;55:74–87. doi: 10.1002/1097-0282(2000)55:1<74::AID-BIP70>3.0.CO;2-S. [DOI] [PubMed] [Google Scholar]
- 129.Meisel H. Bioactive peptides from milk proteins: A perspective for consumers and producers. Aust. J. Dairy Technol. 2001;56:83–92. [Google Scholar]
- 130.Milk Protein Market Size, Share & Trends Analysis Report by Product (Concentrates, Isolates, Hydrolyzed), by Form (Powder, Liquid), by Application (Food & Beverages, Dietary Supplements), by Region, and Segment Forecasts, 2025–2030. 2025. [(accessed on 20 February 2025)]. Available online: https://www.grandviewresearch.com/industry-analysis/milk-protein-market-report.
- 131.Morr C.V., Ha E.Y.W. Whey protein concentrates and isolates: Processing and functional properties. Crit. Rev. Food Sci. Nutr. 1993;33:431–476. doi: 10.1080/10408399309527643. [DOI] [PubMed] [Google Scholar]
- 132.Samtiya M., Samtiya S., Badgujar P.C., Puniya A.K., Dhewa T., Aluko R.E. Health-Promoting and Therapeutic Attributes of Milk-Derived Bioactive Peptides. Nutrients. 2022;14:3001. doi: 10.3390/nu14153001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 133.Hammam A.R.A., Martínez-Monteagudo S.I., Metzger L.E. Progress in micellar casein concentrate: Production and applications. Compr. Rev. Food Sci. Food Saf. 2021;20:4426–4449. doi: 10.1111/1541-4337.12795. [DOI] [PubMed] [Google Scholar]
- 134.Lang Y., Gao H., Tian J., Shu C., Sun R., Li B., Meng X. Protective effects of α-casein or β-casein on the stability and antioxidant capacity of blueberry anthocyanins and their interaction mechanism. Lebensm. Wiss. Technol. 2019;115:108434. doi: 10.1016/j.lwt.2019.108434. [DOI] [Google Scholar]
- 135.El-Salam M.H.A., El-Shibiny S. Preparation and potential applications of casein–polysaccharide conjugates: A review. J. Sci. Food Agric. 2019;100:1852–1859. doi: 10.1002/jsfa.10187. [DOI] [PubMed] [Google Scholar]
- 136.Théolier J., Fliss I., Jean J., Hammami R. Antimicrobial Peptides of Dairy Proteins: From Fundamental to Applications. Food Rev. Int. 2014;30:134–154. doi: 10.1080/87559129.2014.896017. [DOI] [Google Scholar]
- 137.Somkuti G.A., Paul M. Enzymatic fragmentation of the antimicrobial peptides casocidin and isracidin by Streptococcus thermophilus and Lactobacillus delbrueckii ssp. bulgaricus. Appl. Microbiol. Biotechnol. 2010;87:235–242. doi: 10.1007/s00253-009-2433-6. [DOI] [PubMed] [Google Scholar]
- 138.Zhao Q., Shi Y., Wang X., Huang A. Characterization of a novel antimicrobial peptide from buffalo casein hydrolysate based on live bacteria adsorption. J. Dairy Sci. 2020;103:11116–11128. doi: 10.3168/jds.2020-18577. [DOI] [PubMed] [Google Scholar]
- 139.Ribeiro J., Santos M., Silva L., Pereira L., Santos I., Da Silva Lannes S., Da Silva M. Antioxidant and antimicrobial peptides derived from casein: Current trends in food preservation. Food Res. Int. 2019;121:204–211. [Google Scholar]
- 140.Teshome E., Forsido S.F., Rupasinghe H.P.V., Keyata E.O. Potentials of Natural preservatives to Enhance food Safety and shelf life: A review. Sci. World J. 2022;2022:9901018. doi: 10.1155/2022/9901018. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 141.Lorenzo J.M., Munekata P.E., Gómez B., Barba F.J., Mora L., Pérez-Santaescolástica C., Toldrá F. Bioactive peptides as natural antioxidants in food products—A review. Trends Food Sci. Technol. 2018;79:136–147. doi: 10.1016/j.tifs.2018.07.003. [DOI] [Google Scholar]
- 142.Ribeiro J.S., Santos M.J.M.C., Silva L.K.R., Pereira L.C.L., Santos I.A., Da Silva Lannes S.C., Da Silva M.V. Natural antioxidants used in meat products: A brief review. Meat Sci. 2018;148:181–188. doi: 10.1016/j.meatsci.2018.10.016. [DOI] [PubMed] [Google Scholar]
- 143.López-García G., Dublan-García O., Arizmendi-Cotero D., Gómez Oliván L.M. Antioxidant and Antimicrobial Peptides Derived from Food Proteins. Molecules. 2022;27:1343. doi: 10.3390/molecules27041343. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 144.Zhang S., Luo L., Sun X., Ma A. Bioactive peptides: A promising alternative to chemical preservatives for food preservation. J. Agric. Food Chem. 2021;69:12369–12384. doi: 10.1021/acs.jafc.1c04020. [DOI] [PubMed] [Google Scholar]
- 145.Murray N.M., Jacquier J.C., O’Sullivan M., Hallihan A., Murphy E., Feeney E.L., O´Riordan D. Using rejection thresholds to determine acceptability of novel bioactive compounds added to milk-based beverages. Food Qual. Prefer. 2019;73:276–283. doi: 10.1016/j.foodqual.2018.10.014. [DOI] [Google Scholar]
- 146.Guinane C.M., Kent R.M., Norberg S., O’Connor P.M., Cotter P.D., Hill C., Fitzgerald G.F., Stanton C., Ross R.P. Generation of the antimicrobial peptide caseicin A from casein by hydrolysis with thermolysin enzymes. Int. Dairy J. 2015;49:1–7. doi: 10.1016/j.idairyj.2015.04.001. [DOI] [Google Scholar]
- 147.Zhang R., Wang B., Zhang F., Zheng K., Liu Y. Milk-derived antimicrobial peptides incorporated whey protein film as active coating to improve microbial stability of refrigerated soft cheese. Int. J. Food Microbiol. 2024;419:110751. doi: 10.1016/j.ijfoodmicro.2024.110751. [DOI] [PubMed] [Google Scholar]
- 148.Rydlo T., Miltz J., Mor A. Eukaryotic antimicrobial peptides: Promises and premises in food safety. J. Food Sci. 2006;71:R125–R135. doi: 10.1111/j.1750-3841.2006.00175.x. [DOI] [Google Scholar]
- 149.Gogliettino M., Balestrieri M., Ambrosio R.L., Anastasio A., Smaldone G., Proroga Y.T.R., Moretta R., Rea I., De Stefano L., Agrillo B., et al. Extending the Shelf-Life of meat and dairy products via PET-Modified packaging activated with the antimicrobial peptide MTP1. Front. Microbiol. 2020;10:2963. doi: 10.3389/fmicb.2019.02963. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 150.Tkaczewska J. Peptides and protein hydrolysates as food preservatives and bioactive components of edible films and coatings—A review. Trends Food Sci. Technol. 2020;106:298–311. doi: 10.1016/j.tifs.2020.10.022. [DOI] [Google Scholar]
- 151.Santos J.C., Sousa R.C., Otoni C.G., Moraes A.R., Souza V.G., Medeiros E.A., Espitia P.J., Pires A.C., Coimbra J.S., Soares N.F. Nisin and other antimicrobial peptides: Production, mechanisms of action, and application in active food packaging. Innov. Food Sci. Emerg. Technol. 2018;48:179–194. doi: 10.1016/j.ifset.2018.06.008. [DOI] [Google Scholar]
- 152.Khan M.R., Volpe S., Valentino M., Miele N.A., Cavella S., Torrieri E. Active Casein Coatings and Films for Perishable Foods: Structural Properties and Shelf-Life Extension. Coatings. 2021;11:899. doi: 10.3390/coatings11080899. [DOI] [Google Scholar]
- 153.Nakamura Y., Yamamoto N., Sakai K., Takano T. Antihypertensive Effect of Sour Milk and Peptides Isolated from It That are Inhibitors to Angiotensin I-Converting Enzyme. J. Dairy Sci. 1995;78:1253–1257. doi: 10.3168/jds.S0022-0302(95)76745-5. [DOI] [PubMed] [Google Scholar]
- 154.Saito T., Nakamura T., Kitazawa H., Kawai Y., Itoh T. Isolation and structural analysis of antihypertensive peptides that exist naturally in Gouda cheese. J. Dairy Sci. 2000;83:1434–4140. doi: 10.3168/jds.S0022-0302(00)75013-2. [DOI] [PubMed] [Google Scholar]
- 155.Gagnaire V., Mollé D., Herrouin M., Léonil J. Peptides identified during Emmental cheese ripening: Origin and proteolytic systems involved. J. Agric. Food Chem. 2001;49:4402–4413. doi: 10.1021/jf000895z. [DOI] [PubMed] [Google Scholar]
- 156.Gobbetti M., Morea M., Baruzzi F., Corbo M.R., Matarante A., Considine T., Di Cagno R., Guineee T., Fox P.F. 23 Microbiological, compositional, biochemical and textural characterisation of Caciocavallo Pugliese cheese during ripening. Int. Dairy J. 2002;12:511–523. doi: 10.1016/S0958-6946(02)00042-0. [DOI] [Google Scholar]
- 157.Meisel H., Bockelmann W. Bioactive peptides encrypted in milk proteins: Proteolytic activation and thropo-functional properties. Antonie Van Leeuwenhoek. 1999;76:207–215. doi: 10.1023/A:1002063805780. [DOI] [PubMed] [Google Scholar]
- 158.Meisel H., Goepfert A., Gunther S. ACE inhibitory activities in milk products. Milchwissenschaft. 1997;52:307–311. [Google Scholar]
- 159.Rajanna D., Pushpadass H.A., Emerald F.M.E., Padaki N.V., Nath B.S. Nanoencapsulation of CDP within electrospun nanofibres. J. Sci. Food Agric. 2022;102:1684–1698. doi: 10.1002/jsfa.11509. [DOI] [PubMed] [Google Scholar]
- 160.Tadros T., Izquierdo P., Esquena J., Solans C. Formation and stability of nano-emulsions. Adv. Colloid Interface Sci. 2004;108–109:303–318. doi: 10.1016/j.cis.2003.10.023. [DOI] [PubMed] [Google Scholar]
- 161.Silva S.V., Malcata F.X. Partial Identification of Water-Soluble Peptides Released at Early Stages of Proteolysis in Sterilized Ovine Cheese-Like Systems: Influence of Type of Coagulant and Starter. J. Dairy Sci. 2005;88:1947–1954. doi: 10.3168/jds.S0022-0302(05)72870-8. [DOI] [PubMed] [Google Scholar]
- 162.Fan M., Guo T., Li W., Chen J., Li F., Wang C., Shi Y., Li D.X., Zhang S. Isolation and identification of novel casein-derived bioactive peptides and potential functions in fermented casein with Lactobacillus helveticus. Food Sci. Hum. Wellness. 2019;8:156–176. doi: 10.1016/j.fshw.2019.03.010. [DOI] [Google Scholar]
- 163.Coscueta E.R., Batista P., Gomes J.E.G., da Silva R., Pintado M.M. Screening of Novel Bioactive Peptides from Goat Casein: In Silico to In Vitro Validation. Int. J. Mol. Sci. 2022;23:2439. doi: 10.3390/ijms23052439. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 164.Tu M., Qiao X., Wang C., Liu H., Cheng S., Xu Z., Du M. In vitro and in silico analysis of dual-function peptides derived from casein hydrolysate. Food Sci. Hum. Wellness. 2020;10:32–37. doi: 10.1016/j.fshw.2020.08.014. [DOI] [Google Scholar]
- 165.Nascimento L.G.L., Casanova F., Silva N.F.N., De Carvalho Teixeira A.V.N., De Carvalho A.F. Casein-based hydrogels: A mini–review. Food Chem. 2019;314:126063. doi: 10.1016/j.foodchem.2019.126063. [DOI] [PubMed] [Google Scholar]
- 166.Lafarga T., Sánchez-Zurano A., Villaró S., Morillas-España A., Acién G. Industrial production of spirulina as a protein source for bioactive peptide generation. Trends Food Sci. Technol. 2021;116:176–185. doi: 10.1016/j.tifs.2021.07.018. [DOI] [Google Scholar]
- 167.Balandrán-Quintana R.R., Mendoza-Wilson A.M., Montfort G.R., Huerta-Ocampo J.Á., Mazorra-Manzano M.A. Peptides and proteins. Bioact. Compd. Health Dis. 2021;2021:79–117. doi: 10.1007/978-3-030-57469-7_3. [DOI] [Google Scholar]
- 168.Dashper S.G., Liu S.W., Reynolds E.C. Antimicrobial peptides and their potential as oral therapeutic agents. Int. J. Pept. Res. Ther. 2007;13:505–516. doi: 10.1007/s10989-007-9094-z. [DOI] [Google Scholar]
- 169.Reynolds E.C., Dashper S.G., O’Brien-Simpson N.M., Talbo G.H., Malkoski M. Antimicrobial Peptides. EP1032592B1. [(accessed on 15 February 2025)];European Patent. 2007 July 25; Available online: https://patents.google.com/patent/EP1032592B1/en.
- 170.Reynolds E.C., Dashper S.G., Paolini R.A. Antimicrobial Composition. AU2010224414B2. [(accessed on 15 February 2025)];Australian Patent. 2013 May 23; Available online: https://patents.google.com/patent/AU2010224414B2/en.
- 171.Wusigale N., Liang L., Luo Y. Casein and pectin: Structures, interactions, and applications. Trends Food Sci. Technol. 2020;97:391–403. doi: 10.1016/j.tifs.2020.01.027. [DOI] [Google Scholar]
- 172.Sarode A., Sawale P., Khedkar C., Kalyankar S., Pawshe R. Casein and Caseinate: Methods of Manufacture. Elsevier; Amsterdam, The Netherlands: 2015. pp. 676–682. [DOI] [Google Scholar]
- 173.Troch T., Lefébure É., Baeten V., Colinet F., Gengler N., Sindic M. Cow milk coagulation: Process description, variation factors and evaluation methodologies. A review. BASE. 2017;21:276–287. doi: 10.25518/1780-4507.13692. [DOI] [Google Scholar]
- 174.Amaro-Hernández J., Olivas G., Acosta-Muñiz C., Gutiérrez-Méndez N., Rios-Velasco C., Sepulveda D.R. Chemical interactions among caseins during rennet coagulation of milk. J. Dairy Sci. 2021;105:981–989. doi: 10.3168/jds.2021-21071. [DOI] [PubMed] [Google Scholar]
- 175.López-Fandiño R., Ramos M., Olano A. Rennet coagulation of milk subjected to high pressures. J. Agric. Food Chem. 1997;45:3233–3237. doi: 10.1021/jf960879v. [DOI] [Google Scholar]
- 176.De Kort E., Minor M., Snoeren T., Van Hooijdonk T., Van Der Linden E. Effect of calcium chelators on heat coagulation and heat-induced changes of concentrated micellar casein solutions: The role of calcium-ion activity and micellar integrity. Int. Dairy J. 2012;26:112–119. doi: 10.1016/j.idairyj.2012.03.014. [DOI] [Google Scholar]
- 177.O’Connell J., Fox P. The Two-Stage coagulation of milk proteins in the minimum of the heat coagulation Time-PH profile of milk: Effect of Casein micelle size. J. Dairy Sci. 2000;83:378–386. doi: 10.3168/jds.S0022-0302(00)74892-2. [DOI] [PubMed] [Google Scholar]
- 178.Carter B., Cheng N., Kapoor R., Meletharayil G., Drake M. Invited review: Microfiltration-derived casein and whey proteins from milk. J. Dairy Sci. 2021;104:2465–2479. doi: 10.3168/jds.2020-18811. [DOI] [PubMed] [Google Scholar]
- 179.Tomasula P.M., Craig J.C., Boswell R. A continuous process for casein production using high-pressure carbon dioxide. J. Food Eng. 1997;33:405–419. doi: 10.1016/S0260-8774(97)00053-8. [DOI] [Google Scholar]
- 180.Nelson B., Lynch J., Barbano D. Impact of Milk Preacidification with CO2 on the Aging and Proteolysis of Cheddar Cheese. J. Dairy Sci. 2004;87:3590–3600. doi: 10.3168/jds.S0022-0302(04)73497-9. [DOI] [PubMed] [Google Scholar]
- 181.Pomastowski P., Walczak J., Gawin M., Bocian S., Piekoszewski W., Buszewski B. HPLC separation of casein components on a diol-bonded silica column with MALDI TOF/TOF MS identification. Anal. Methods. 2014;6:5236–5244. doi: 10.1039/C4AY00895B. [DOI] [Google Scholar]
- 182.Yaguchi M., Rose D. Chromatographic Separation of milk Proteins: A review. J. Dairy Sci. 1971;54:1725–1743. doi: 10.3168/jds.S0022-0302(71)86106-4. [DOI] [PubMed] [Google Scholar]
- 183.Gani A., Broadway A.A., Masoodi F.A., Wani A.A., Maqsood S., Ashwar B.A., Shah A., Rather S.A., Gani A. Enzymatic hydrolysis of whey and casein protein- effect on functional, rheological, textural and sensory properties of breads. J. Food Sci. Technol. 2015;52:7697–7709. doi: 10.1007/s13197-015-1840-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 184.Wang L., Shao X., Cheng M., Fan X., Wang C., Jiang H., Zhang X. Mechanisms and applications of milk-derived bioactive peptides in Food for Special Medical Purposes. Int. J. Food Sci. Technol. 2022;57:2830–2839. doi: 10.1111/ijfs.15622. [DOI] [Google Scholar]
- 185.Ao J., Li B. Stability and antioxidative activities of casein peptide fractions during simulated gastrointestinal digestion in vitro: Charge properties of peptides affect digestive stability. Food Res. Int. 2013;52:334–341. doi: 10.1016/j.foodres.2013.03.036. [DOI] [Google Scholar]
- 186.Wang C., Wang B., Li B. Bioavailability of peptides from casein hydrolysate in vitro: Amino acid compositions of peptides affect the antioxidant efficacy and resistance to intestinal peptidases. Food Res. Int. 2015;81:188–196. doi: 10.1016/j.foodres.2015.12.013. [DOI] [Google Scholar]
- 187.Wang S., Lin Q., Liang Y. Recent advances in the application of novel carriers for peptide delivery. J. Agric. Food Res. 2025;19:101628. doi: 10.1016/j.jafr.2024.101628. [DOI] [Google Scholar]
- 188.Omidian H., Wilson R.L., Castejon A.M. Recent Advances in Peptide-Loaded PLGA Nanocarriers for Drug Delivery and Regenerative Medicine. Pharmaceuticals. 2025;18:127. doi: 10.3390/ph18010127. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 189.Jiang E.Y., Desroches S.T., Mikos A.G. Particle carriers for controlled release of peptides. J. Control. Release. 2023;360:953–968. doi: 10.1016/j.jconrel.2023.03.050. [DOI] [PubMed] [Google Scholar]
- 190.Oliveira C.B.P., Gomes V., Ferreira P.M.T., Martins J.A., Jervis P.J. Peptide-Based Supramolecular Hydrogels as Drug Delivery Agents: Recent Advances. Gels. 2022;8:706. doi: 10.3390/gels8110706. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 191.Peng T., Fu H., Ma X. Design, optimization, and nanotechnology of antimicrobial peptides: From exploration to applications. Nanotoday. 2021;39:101229. doi: 10.1016/j.nantod.2021.101229. [DOI] [Google Scholar]
- 192.Wenck C., Meier N., Heinrich E., Grützner V., Wiekhorst F., Bleul R. Design and characterisation of casein coated and drug loaded magnetic nanoparticles for theranostic applications. RSC Adv. 2024;14:26388–26399. doi: 10.1039/D4RA02626H. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 193.Lombardi L., Li J., Williams D.R. Peptide-Based Biomaterials for Combatting Infections and Improving Drug Delivery. Pharmaceutics. 2024;16:1468. doi: 10.3390/pharmaceutics16111468. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 194.Liu Y., Sameen D.E., Ahmed S., Dai J., Qin W. Antimicrobial peptides and their application in food packaging. Trends Food Sci. Technol. 2021;112:471–483. doi: 10.1016/j.tifs.2021.04.019. [DOI] [Google Scholar]
- 195.Duda-Chodak A., Tarko T., Petka-Poniatowska K. Antimicrobial Compounds in Food Packaging. Int. J. Mol. Sci. 2023;24:2457. doi: 10.3390/ijms24032457. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 196.Fahimirad S., Abtahi H., Razavi S.H., Alizadeh H., Ghorbanpour M. Production of recombinant antimicrobial polymeric protein beta casein-E 50-52 and its antimicrobial synergistic effects assessment with thymol. Molecules. 2017;22:822. doi: 10.3390/molecules22060822. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 197.Guan T., Li J., Chen C., Liu Y. Self-Assembling Peptide-Based hydrogels for wound tissue repair. Adv. Sci. 2022;9:2104165. doi: 10.1002/advs.202104165. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 198.Thapa R.K., Diep D.B., Tønnesen H.H. Topical antimicrobial peptide formulations for wound healing: Current developments and future prospects. Acta Biomater. 2019;103:52–67. doi: 10.1016/j.actbio.2019.12.025. [DOI] [PubMed] [Google Scholar]
- 199.Patel H.R., Patel G.N., Patel R.K. Formulation and evaluation of oral mucosal casein salt film for the anti-diabetic activity. Polym. Sci. 2017;03 doi: 10.4172/2471-9935-C1-002. [DOI] [Google Scholar]
- 200.Tan S., Hadinoto K., Ebrahimi A., Langrish T. Fabrication of novel casein gel with controlled release property via acidification, spray drying and tableting approach. Colloids Surf. B Biointerfaces. 2019;177:329–337. doi: 10.1016/j.colsurfb.2019.02.019. [DOI] [PubMed] [Google Scholar]
- 201.Simão A.R., Fragal V.H., Pellá M.C.G., Garcia F.P., Nakamura C.V., Silva R., Tambourgi E.B., Rubira A.F. Drug polarity effect over the controlled release in casein and chondroitin sulfate-based hydrogels. Int. J. Biol. Macromol. 2020;158:116–126. doi: 10.1016/j.ijbiomac.2020.04.179. [DOI] [PubMed] [Google Scholar]
- 202.Simão A.R., Fragal V.H., De Oliveira Lima A.M., Pellá M.C.G., Garcia F.P., Nakamura C.V., Tambourgi E.B., Rubira A.F. pH-responsive hybrid hydrogels: Chondroitin sulfate/casein trapped silica nanospheres for controlled drug release. Int. J. Biol. Macromol. 2020;148:302–315. doi: 10.1016/j.ijbiomac.2020.01.093. [DOI] [PubMed] [Google Scholar]
- 203.Li N., Fu C., Zhang L. Using casein and oxidized hyaluronic acid to form biocompatible composite hydrogels for controlled drug release. Mater. Sci. Eng. C Mater. Biol. Appl. 2014;36:287–293. doi: 10.1016/j.msec.2013.12.025. [DOI] [PubMed] [Google Scholar]
- 204.Tundisi L.L., Yang R., Borelli L.P.P., Alves T., Mehta M., Chaud M.V., Mazzola P.G., Kohane D.S. Enhancement of the Mechanical and Drug-Releasing Properties of Poloxamer 407 Hydrogels with Casein. Pharm. Res. 2021;38:515–522. doi: 10.1007/s11095-021-03017-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 205.Upputuri R.T.P., Mandal A.K.A. Mathematical Modeling and Release Kinetics of Green Tea Polyphenols Released from Casein Nanoparticles. Iran. J. Pharm. Res. 2019;18:1137–1146. doi: 10.22037/ijpr.2019.1100715. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 206.Maeno M., Nakamura Y., Mennear J.H., Bernard B.K. Studies of the Toxicological Potential of Tripeptides (L-Valyl-L-prolyl-L-proline and L-lsoleucyl-L-prolyl-L-proline): III. Single- and/or Repeated-Dose Toxicity of Tripeptides-Containing Lactobacillus helveticus-Fermented Milk Powder and Casein Hydrolysate in Rats. Int. J. Toxicol. 2005;24:13–23. doi: 10.1080/10915810500259556. [DOI] [PubMed] [Google Scholar]
- 207.Mizuno S., Mennear J.H., Matsuura K., Bernard B.K. Studies of the toxicological potential of tripeptides (L-Valyl-L-prolyl-L-proline and L-lsoleucyl-L-prolyl-L-proline): V. A 13-Week toxicity Study of Tripeptides-Containing Casein Hydrolysate in male and female rats. Int. J. Toxicol. 2005;24:41–59. doi: 10.1080/10915810500259606. [DOI] [PubMed] [Google Scholar]
- 208.Kurosaki T., Maeno M., Mennear J.H., Bernard B.K. Studies of the Toxicological Potential of Tripeptides (L-Valyl-L-prolyl-L-proline and L-lsoleucyl-L-prolyl-L-proline): VI. Effects of Lactobacillus helveticus-fermented Milk Powder on Fertility and Reproductive Performance of Rats. Int. J. Toxicol. 2005;24:61–89. doi: 10.1080/10915810500259630. [DOI] [PubMed] [Google Scholar]
- 209.Doorten A.P., Wiel J.V., Jonker D. Safety evaluation of an IPP tripeptide-containing milk protein hydrolysate. Food Chem. Toxicol. 2008;47:55–61. doi: 10.1016/j.fct.2008.10.001. [DOI] [PubMed] [Google Scholar]
- 210.Matsufuji H., Matsui T., Ohshige S., Kawasaki T., Osajima K., Osajima Y. Antihypertensive effects of angiotensin fragments in SHR. Biosci. Biotechnol. Biochem. 1995;59:1398–1401. doi: 10.1271/bbb.59.1398. [DOI] [PubMed] [Google Scholar]
- 211.Tsuchita H., Suzuki T., Kuwata T. The effect of casein phosphopeptides on calcium absorption from calcium-fortified milk in growing rats. Br. J. Nutr. 2001;85:5–10. doi: 10.1079/BJN2000206. [DOI] [PubMed] [Google Scholar]
- 212.Scientific Concepts of Functional Foods in Europe Consensus Document. Br. J. Nutr. 1999;81:1–27. doi: 10.1017/S0007114599000471. [DOI] [PubMed] [Google Scholar]
- 213.Hartmann R., Meisel H. Caseinophosphopeptides and their cell modulating potential. BioFactors. 2004;21:73–78. doi: 10.1002/biof.552210114. [DOI] [PubMed] [Google Scholar]
- 214.Urista C.M., Fernández R.Á., Rodriguez F.R., Cuenca A.A., Jurado A.T. Review: Production and functionality of active peptides from milk. Food Sci. Technol. Int. 2011;17:293–317. doi: 10.1177/1082013211398801. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Data Availability Statement
Not applicable.




