Skip to main content
mBio logoLink to mBio
. 2025 Apr 28;16(6):e00603-24. doi: 10.1128/mbio.00603-24

Candidalysin biology and activation of host cells

Léa Lortal 1,, Claire M Lyon 1, Jakob L Sprague 2, Johannes Sonnberger 2, Olivia K A Paulin 1, Don N Wickramasinghe 1, Jonathan P Richardson 1, Bernhard Hube 2,3,4, Julian R Naglik 1
Editor: Marcio Rodrigues5
PMCID: PMC12153327  PMID: 40293285

ABSTRACT

Candida albicans is an opportunistic fungal pathogen that can cause life-threatening systemic infections and distressing mucosal infections. A major breakthrough in understanding C. albicans pathogenicity was the discovery of candidalysin, the first cytolytic peptide toxin identified in a human pathogenic fungus. Secreted by C. albicans hyphae and encoded by the ECE1 gene, this 31-amino acid peptide integrates into and permeabilizes host cell membranes, causing damage across diverse cell types. Beyond its cytolytic activity, candidalysin can trigger potent innate immune responses in epithelial cells, macrophages, and neutrophils. Additionally, candidalysin plays a key role in nutrient acquisition during infection. This review explores the biology of candidalysin, its role in host cell activation, and extends the discussion to non-candidalysin Ece1p peptides, shedding light on their emerging significance.

KEYWORDS: Candida albicans, candidalysin, fungal infection, immune mechanisms, toxins

INTRODUCTION

Fungal infections are a major threat to global health, affecting over 1 billion people worldwide and killing 3.8 million people every year (13). Alarmingly, fungal infections kill almost three times more individuals than tuberculosis and six times more than malaria (World Health Organization, 2022). Despite these high numbers, fungal diseases remain largely neglected and understudied.

Fungal infections can manifest as superficial (e.g., nails and skin), mucosal (e.g., oral and vaginal), or invasive (e.g., bloodstream and organs). Invasive fungal infections affect over 6.5 million people per year and have an alarming average mortality rate of 50% (1, 2). Among the most common pathogens responsible for mucosal and systemic fungal infections is Candida albicans. C. albicans is a normal component of the human microbiota, commonly colonizing the mouth, gastrointestinal tract, and vagina of healthy individuals (46). However, under certain conditions, this opportunistic pathogen can proliferate and cause distressing mucosal infections, such as vulvovaginal candidiasis (VVC) and oral candidiasis. Notably, approximately 75% of women experience VVC at least once in their lifetime (7, 8), and recurrent VVC (RVVC; defined as four or more VVC episodes per year) affects 138 million women annually (8, 9). Oral candidiasis further burdens global health, affecting 15 million people each year (1). In addition to mucosal infections, C. albicans is a leading cause of invasive candidiasis, one of the most prevalent and life-threatening invasive fungal infections globally (1, 10).

Current medications for mucosal infections are relatively effective but are not preventive. Thus, there is currently no adequate treatment against RVVC. Risk factors for mucosal infections include pregnancy, immunosuppression, genetic predispositions, and use of antibiotics, glucocorticoids, and oral contraceptives (4, 6, 7).

C. albicans virulence attributes include morphological transitions, factors facilitating adhesion and invasion, the production of hydrolytic enzymes, biofilm formation, escape from phagocytosis, and evasion from the host immune system (11, 12). A fundamental advance in understanding the pathogenicity of C. albicans was the discovery of candidalysin, a cytolytic peptide toxin secreted by C. albicans hyphae (13). Candidalysin is the first cytolytic peptide toxin to be identified in any human pathogenic fungus. This 31-amino acid peptide intercalates and permeabilizes host cell membranes, causing damage across various cell types. Through its activity, candidalysin also triggers robust innate immune responses in the host (13, 14). In recent years, there has been a plethora of studies on candidalysin and how the toxin drives infection and immune responses in several different model systems. As such, this review will focus predominantly on candidalysin biology and its role in activating host cells during infection. The reader is guided to several other reviews that focus on the role of candidalysin in driving downstream immune responses and other disease states (1419).

CANDIDALYSIN PRODUCTION AND SECRETION

The success of C. albicans both as a commensal and pathogen resides in its remarkable capacity to adapt to different host niches and environmental cues. Such adaptability is most evident in the context of morphological plasticity at mucosal surfaces. Indeed, C. albicans is a polymorphic fungus that can grow as ovoid-shaped yeasts, pseudohyphae, and hyphae (20). Morphological transitions are a key virulence factor, as hyphae can breach epithelial barriers and penetrate underlying tissues and are, therefore, synonymous with mucosal infections (2125). However, the yeast form has also been associated with dissemination, highlighting the importance of morphological plasticity (11).

The yeast-to-hypha transition can be induced by several factors, including endogenous cues, such as cell cycle progression, and environmental stimuli, such as exposure to serum, temperature (37°C), 5% carbon dioxide, neutral pH, and the presence of N-acetylglucosamine (2629). The hyphal morphology is regulated by three main signal transduction pathways: the cAMP-PKA (cyclic adenosine monophosphate-protein kinase A) pathway, which targets the transcription factor enhanced filamentous growth protein 1 (Efg1), the Cek1 MAPK (extracellular signal-regulated kinase mitogen-activated protein kinase) pathway, and the pH response pathway (27, 30). Signaling through these pathways converges on transcriptional activators, including Cph1p, Flo8p, Ume6p, and Tec1p, which control the expression of hypha-associated genes (31, 32). Cell density and interactions with other microorganisms via quorum sensing molecules, such as farnesol, can also induce transitions from one morphology to the other, which activates transcriptional repressors, such as Nrg1p, Rfg1p, and the co-repressor Tup1p which downregulate the expression of hypha-associated genes (11, 2729).

A core filamentation response network comprising only eight genes was originally identified (33), which is upregulated following a change in pH (from pH 4 to 8), in the presence of 10% human B serum and following a change in carbon source (from glucose to N-acetylglucosamine) and was expanded recently (34). This network includes genes whose proteins have known (or likely) cell wall-associated functions (ALS3, HGT2, HWP1, IHD1, RBT1), DCK1 (a putative guanine nucleotide exchange factor), orf19.2457 (an ORF of unknown function), and ECE1.

Candidalysin is encoded by the Extent of Cell Elongation 1 (ECE1) gene, which is strongly upregulated during hyphal growth (13, 33, 35). Although strongly expressed in hyphae, Ece1p is not required for hyphal growth (13, 35) but instead plays a crucial role in virulence (13). Truncation analysis of the 3,197 bp ECE1 intergenic region demonstrated that the ECE1 promoter has a minimal size of 1,500 bp and a TATA element located 106–109 nucleotides upstream of the start codon (36). The presence of numerous transcription factor binding sites in the ECE1 promoter suggests that the regulation of ECE1 expression is likely a complex event. However, so far, only Ahr1p and Tup1p have been shown to play a direct role in ECE1 regulation (37).

Following expression, ECE1 mRNA transcripts are translated, and Ece1p transits through the fungal endomembrane system. The Ece1p pre-pro-protein contains 271 amino acids. A notable feature of Ece1p is the presence of seven dibasic lysine-arginine (KR) motifs dispersed throughout the protein (35). Ece1p is processed sequentially by two kexin proteinases: first by the endoproteinase Kex2p, which cleaves Ece1p after each KR motif to produce seven short peptides and an immature candidalysin toxin containing a C-terminal arginine (SIIGIIMGILGNIPQVIQIIMSIVKAFKGNKR), and then by the carboxypeptidase Kex1p, which removes the C-terminal arginine to produce the mature toxin terminating in lysine. Candidalysin is the third peptide (amino acid positions 62–92; SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK) (Fig. 1) (13, 38, 39). Efficient processing of C. albicans Ece1p after Arg61 and Arg93 is critical for pathogenicity, as alanine substitution at these positions attenuates virulence in vivo (39). Indeed, natural variations in the amino acid sequence of the candidalysin P2–P3-processing site within Ece1p have a profound influence on the efficiency of kexin-mediated processing and, hence, candidalysin production, which in turn has a direct impact on virulence in vivo (40).

Fig 1.

Ece1p amino acid sequence depicts Kex2p and Kex1p cleavage sites at KR motifs. Cleavage yields eight peptides, including Ece1-III, which is processed into mature candidalysin, highlighted with bold and underlined sequence.

Candidalysin generation by C. albicans. The ECE1 gene is strongly expressed during C. albicans hyphal growth and encodes Ece1p, a polypeptide of 271 amino acids. The polypeptide is sequentially processed, first by Kex2p at lysine-arginine (KR) motifs (in red) to produce eight peptides, and then by Kex1p, which cleaves the terminal arginine residues. Candidalysin is the third peptide (position 62–92) and is 31 amino acids in length. SP = signal peptide. Created with BioRender.com.

The secreted candidalysin peptide is amphipathic and α-helical and resembles catanionic antimicrobial peptides and peptide toxins, such as melittin and alamethicin (13). A recent study has shown that candidalysin pre-assembles in solution into polymer loops of several 8-mers, which then intercalate into the membrane, forming large, cyclo-octameric permeabilizing pores (41).

CANDIDALYSIN AND EPITHELIAL CELLS

The mucosal epithelium is a key site of C. albicans colonization and infection and is the first line of defence, providing a physical barrier against tissue invasion. Adhesion to epithelial cells is an essential pre-requisite for commensal colonization and pathogenic invasion (23, 42). C. albicans hyphae express numerous adhesins, including agglutinin-like sequence 3 (Als3p) and hyphal wall protein 1 (Hwp1p). Als3p binds to epithelial receptors, such as E-cadherin, whereas Hwp1p covalently bonds to the cell after being processed by host transglutaminases (4346). Once adhered, hyphae can invade epithelial cells by two distinct and complementary mechanisms: active penetration (AP) and receptor-induced endocytosis (RIE) (45, 47, 48). AP is the primary mode of invasion, whereby extending hyphae physically exert force onto the host cell while secreting hydrolytic enzymes (48). These enzymes include phospholipases, lipases, and secreted aspartyl proteases, which can degrade host membrane phospholipids, triglycerides, and peptides (49). Conversely, RIE is a host-driven process, whereby the epidermal growth factor receptor (EGFR) and Her2 on the host cell surface interact with fungal-surface invasins Als3p and Ssa1p, triggering phosphorylation events, which stimulate endocytosis (50, 51). AP and RIE result in the formation of an invasion pocket (Fig. 2A), in which the invading hyphal tip is encased within the invaginated host cell membrane (52). Candidalysin is secreted into this invasion pocket, where it accumulates and then intercalates into the host cell membrane, forming pores (41, 52). This destabilizes the host plasma membrane and leads to the release of cellular contents, including lactate dehydrogenase (LDH), antimicrobial peptides, and alarmins (13, 14, 53), ultimately inducing cell death. Interestingly, candidalysin does not cause cell death by apoptosis, as programmed cell death markers, such as activation of caspases 3 or 8 or cleavage of poly(ADP-ribose) polymerase, are not reported to occur (54). However, candidalysin induces rapid mitochondrial dysfunction by reducing intracellular ATP, reducing mitochondrial membrane potential (ΔΨm), increasing intracellular reactive oxygen species (ROS), and promoting the release of cytochrome c into the extracellular environment (Fig. 2B). Collectively, these data demonstrate that cell death occurs through a necrotic mechanism (54). Additionally, ΔΨm depolarization does not take place in the absence of extracellular calcium, indicating calcium influx is important for mitochondrial dysfunction (54). It is well reported that candidalysin causes the rapid influx of extracellular calcium ions into epithelial cells in vitro (13, 5456). Candidalysin-induced calcium influx has been quantified in epithelial cells by whole-cell patch clamping, Fura-2 binding (13), and by using genetically encoded fluorescent calcium sensors (GCaMP6s) (56). The use of GCaMP6s demonstrated that transient spikes in the level of intracellular calcium occurred up to once every 5 min, returning to baseline in between spikes. Calcium spikes coincided with plasma membrane blebbing (visible within 10 min), in which candidalysin-containing membrane was “pinched off” from the treated cell and released into the extracellular environment. Notably, blebbing required components of the cellular repair complex, including apoptosis-linked gene 2 (ALG-2), ALG-2-interacting protein X (ALIX), and “endosomal sorting complex required for transport-III” (ESCRT-III), suggesting calcium influx may contribute to the host’s attempt to remove candidalysin and repair membrane damage (56).

Fig 2.

Illustration depicts C. albicans secreting candidalysin, which triggers EGFR/HER2 activation, calcium influx, and mitochondrial dysfunction in epithelial cells. Signaling cascades lead to p38 and ERK1/2 activation and immune cell recruitment.

Candidalysin activates epithelial cells. C. albicans hyphae are recognized by epithelial cells through the binding of host surface proteins, such as EGFR/HER2, to invasins and adhesins like Als3p, creating the invasion pocket (A). Candidalysin is secreted by hyphae and accumulates in the invasion pocket. It forms pores in the plasma membrane of epithelial cells, triggering calcium influx and LDH release. Candidalysin induces mitochondrial dysfunction by reducing intracellular ATP, reducing mitochondrial membrane potential (ΔΨm), increasing intracellular reactive oxygen species (ROS), and promoting the release of cytochrome c into the extracellular environment (B). Calcium influx stimulates the activation of matrix metalloproteinases, which release surface-tethered epidermal growth factor receptor (EGFR) ligands. These ligands bind to EGFR, triggering receptor dimerization and activation (C). EGFR activation stimulates ERK1/2, which activates the MAPK phosphatase MKP1. The transcription factor c-Fos is then activated, leading to the expression of cytokines (G-CSF, GM-CSF, IL-1α, and IL-1β), which are released from the cell and stimulate neutrophil recruitment and type 17 immunity at the site of infection. In parallel, candidalysin activates the p38-MAPK pathway, which can also activate EGFR and Hsp27 and stimulate IL-6 secretion (D). Created with BioRender.com.

In addition, in oral epithelial cells, calcium influx also indirectly activates matrix metalloproteinases, which cleave surface-tethered ligands, such as epigen, epiregulin, and amphiregulin. These ligands in turn bind and activate EGFR (Fig. 2C) (55). EGFR is a key receptor in mammalian cells, regulating numerous signalling pathways involved in cell growth, survival, division, differentiation, angiogenesis, and migration. EGFR activation by candidalysin triggers the extracellular signal-regulated kinase 1/2 (ERK1/2) MAPK pathway, leading to the expression and phosphorylation of the MAPK phosphatase MKP1 (14, 55, 57, 58). The ERK1/2 pathway also induces the expression of the transcription factor c-Fos, driving the production of immune-modulatory cytokines, such as granulocyte colony-stimulating factor (G-CSF), granulocyte-macrophage colony-stimulating factor (GM-CSF), and interleukins 1α and β (IL-1α and IL-1β). Simultaneously, candidalysin also activates the p38 signalling pathway through two independent routes: MKK3/6 and proto-oncogene tyrosine-protein kinase Src (Fig. 2D). MKK3/6 phosphorylates p38, ultimately leading to the production of interleukin 6 (IL-6), while Src also phosphorylates p38 but instead triggers EGFR activation in a ligand-independent manner (59). Both routes activate heat shock protein 27 (Hsp27) (59), but the function of this protein during infection is unknown. The release of cytokines induces neutrophil recruitment and type 17 immunity; both crucial for host protection against oral candidiasis (13, 14, 55, 59, 60). Furthermore, IL-1α release triggers an early innate immune response in nearby epithelial cells via the IL-1 receptor (IL-1R) and NF-κβ signalling, leading to the production of additional pro-inflammatory cytokines and chemokines (61).

Candidalysin also activates five EGFR adaptors in oral epithelial cells: Grb2-associated-binding protein 1 (Gab1), growth factor receptor-bound protein 2 (Grb2), Src homology two and collagen protein (Shc), SH2-containing protein tyrosine phosphatase-2 (Shp2), and casitas B-lineage lymphoma (c-Cbl). These adaptors regulate ERK1/2-MAPK signaling and are shown to influence cytokine secretion when inhibited using small interfering RNA (62). Furthermore, during infection, EGFR and the ephrin type-A receptor 2 (EphA2) form a complex and activate each other mutually. Candidalysin activates both receptors, stimulating pro-inflammatory cytokine and chemokine secretion, while C. albicans binding to the EphA2-EGFR complex prevents receptor degradation (63).

CANDIDALYSIN AND NEUTROPHILS

Neutrophils are an important part of the innate immune system and play a key role in host defence against fungal infections (64). Candidalysin has been identified as an inducer of neutrophil infiltration, with studies demonstrating significantly reduced neutrophil recruitment in murine models of oropharyngeal candidiasis (OPC) and zebrafish models of mucosal infection following infection with ece1Δ/Δ (13). In vaginal epithelial cells, candidalysin also causes damage and pro-inflammatory cytokine release, such as G-CSF, GM-CSF, and IL-1β, all of which are strongly linked to neutrophil recruitment (65). Neutralization of candidalysin by specific nanobodies can block epithelial damage, pro-inflammatory cytokine release, and neutrophil recruitment (66). Likewise, in a murine model of VVC, significantly fewer neutrophils were recruited in response to ece1Δ/Δ or the candidalysin null strain ece1Δ/Δ + ECE1Δ184–279 compared to wild-type C. albicans-infected mice (65). However, while neutrophil recruitment triggers protective immune responses in OPC, it drives pathology in VVC by causing acute inflammation and exacerbating symptoms (67). Indeed, polymorphonuclear neutrophils may have limited protective function during VVC and struggle to reduce fungal burdens at the vaginal mucosa (68, 69).

Similarly, candidalysin is required for systemic murine neutrophil recruitment, as infection with ece1Δ/Δ leads to significantly reduced secretion of neutrophil-recruiting chemokines (e.g., CXCL1 and CXCL8), as well as reduced renal neutrophil infiltration (70). Nonetheless, one study found that the survival rate of mice infected with candidalysin-deficient strains was 100% at day 7 compared to 25% for mice infected with candidalysin-producing strains. Interestingly, mice infected with candidalysin-deficient strains had a significant increase in fungal burden in the spleen, kidney, and brain compared to wild-type C. albicans (70). This suggests that during systemic infection, fungal burden can be decoupled from the severity of infection and that other virulence factors, such as candidalysin secretion, are more important for driving pathogenicity.

In the brain, candidalysin stimulates protective neutrophil recruitment, whereby the toxin engages CARD9-positive microglia through CD11b to induce the secretion of IL-1β and CXCL1. IL-1β and CXCL1 recruit CXCR2-expressing neutrophils, leading to fungal clearance (71, 72).

Candidalysin has also been linked to the formation of neutrophil extracellular traps (NETs) (73). NETs are an extracellular mechanism used alongside phagocytic neutrophil killing, which enhance fungal eradication in a NADPH oxidase-dependent manner. However, if released in excess, the pro-inflammatory function of NETs can negatively impact the host (74). In addition to NETs, microbial toxins can induce leucotoxic hypercitrullination of histones found in neutrophils, which can cause NET-like structures (NLS) to form. NLS act in a NADPH-independent manner and are more compact and less fibrous than NETs, but both have similar functions (75).

In a recent study, candidalysin-deficient strains were shown to induce fewer NETs than candidalysin-expressing strains. Synthetic candidalysin was found to act as a stimulus for leucotoxic hypercitrullination and, thus, NLS release; however, NET formation was unaffected. This candidalysin-induced NLS activation relied partly on NADPH oxidase-mediated ROS production, as well as peptidyl arginine deiminase 4 (PAD4)-mediated histone citrullination (73). Interestingly, NETs are also induced by various C. albicans isolates, including strain 101, which expresses very low levels of the ECE1 gene (76). These findings suggest a potential decoupling of candidalysin from NETosis—a form of neutrophil cell death that results in the NET and NLS release (76). In another study, which examined catheter-associated biofilms under a total parenteral nutrition environment, C. albicans clinical isolates with low candidalysin secretion levels exhibited resistance to neutrophil-mediated biofilm clearance, with undetectable NETosis. Treatment with synthetic candidalysin induced NETosis and aided the removal of biofilms, suggesting the toxin can be downregulated to promote C. albicans persistence in intravascular catheters (77).

CANDIDALYSIN AND MACROPHAGES

In addition to neutrophils, macrophages and dendritic cells are important first-line responders to C. albicans infection. The primary function of macrophages is to phagocytose fungal cells, containing them in the phagosome, which then matures and leads to the intracellular killing of the fungus. However, in vitro studies have shown that a portion of intracellular C. albicans cells can form hyphae in the phagosome within a few hours, leading to the production and secretion of candidalysin (78, 79). Furthermore, macrophages may also encounter non-phagocytosed filaments of C. albicans, resulting in extracellular exposure to candidalysin. In both cases, the toxin induces macrophage cell death (79, 80). Notably, intracellular production of candidalysin contributes substantially to C. albicans escape from macrophages (79).

Macrophages can undergo different forms of programmed cell death as a response to the intracellular proliferation of phagocytosed pathogens. These pathways are also activated by intracellular C. albicans cells (81), with pyroptosis being the most prominent pathway induced (8284). Pyroptosis of macrophages is characterized by host cell activation via intracellular multi-protein pattern recognition receptors. An example is the activation of the NLRP3 inflammasome, which comprises NLRP3, ASC, and pro-caspase 1. Upon NLRP3 inflammasome activation, pro-caspase 1 is cleaved and activated, leading to the processing and activation of the pore-forming protein GSDMD and the cytokine IL-1β (85). IL-1β is then predominantly released through GSDMD pores (86). The expression, assembly, and function of the NLRP3 inflammasome require priming and an activation signal, which are both provided by C. albicans (80). Indeed, intra- and extra-cellular candidalysin can act as an activation signal for the NLRP3 inflammasome following priming by factors, such as LPS or β-glucan (80, 87). In primary dendritic cells lacking components of the NLRP3 inflammasome, IL-1β release was completely abolished after infection with either C. albicans or treatment with synthetic candidalysin (80). In contrast, LDH release from phagocytes remained unchanged, suggesting that candidalysin-mediated host cell damage can occur independently of host inflammasome signaling (80).

Since candidalysin plays a key role in complex cellular processes within the host, understanding its subcellular localization and function with spatial and temporal precision is of particular interest. Although ECE1 is expressed in germinating C. albicans cells within the phagosome, candidalysin is dispensable for phagosomal escape, even under conditions of forced overexpression in a yeast-locked mutant (88). Given that membrane composition influences candidalysin’s activity (89), it is conceivable that the phagosome membrane is resistant to candidalysin-mediated damage, leading to its accumulation within the phagosome. Upon filament-induced rupture of the phagosome, candidalysin may leak into the cytosol, gaining access to the macrophage plasma membrane (88). As a host defence strategy, calcium-dependent lysosomal fusion is required to contain elongating C. albicans filaments in an intact phagosome (78). Over time, nearly all cellular lysosomes are integrated into this process. Inhibition of this mechanism results in premature and increased activation of the NLRP3 inflammasome, potentially driven by candidalysin’s release into the cytoplasm and extracellular space (78).

While candidalysin-supported escape from macrophages benefits C. albicans, the resulting production of IL-1β can have niche-specific consequences that can be both advantageous or detrimental to the host and the fungus (16).

CANDIDALYSIN AND PLATELETS

In the lung and oral cavity, candidalysin also has an effect on platelets. In the lung, candidalysin was identified as a key driver of C. albicans-mediated allergic airway disease (90). Mice infected with an ece1Δ/Δ mutant display significantly less airway hyperresponsiveness, reduced recruitment of immune cells, such as macrophages and neutrophils, and reduced cytokine secretion compared to mice infected with wild-type C. albicans. The toxin activates platelets by binding to the GP1bα receptor and induces the release of Dickkopf 1 (Dkk-1), leading to Th2 and Th17 cell responses. In the oral cavity, candidalysin activates tongue megakaryocytes to release platelets with antifungal capacity. Infection with a candidalysin-deficient strain resulted in decreased expansion of megakaryocytes during oral infection. Direct interaction between platelets and neutrophils was required since neutrophil influx was prevented when mice were treated with an anti-PSGL-1 antibody (which blocks the primary ligand for the platelet surface protein P-selectin), while transfusion of platelets rescued the neutrophil defect (91).

CANDIDALYSIN AND ITS BINDING PARTNERS

Candidalysin appears to have several modes of action on a given host cell. Biophysical analysis revealed that candidalysin can directly intercalate into synthetic dioleoylphosphatidylcholine plasma membranes in vitro and forms pores into host plasma membranes to lyse cells (13, 41). However, notably, candidalysin does not integrate into C. albicans membranes, suggesting specificity for human membranes (89). Candidalysin can also directly bind host proteins, such as GP1bα on platelets, which can drive C. albicans-mediated allergic airway disease through the release of Dkk-1 (90). Candidalysin can also bind the integrin CD11b on microglia, which leads to protective neutrophil responses during C. albicans cerebritis (72).

Importantly, given that candidalysin is a toxin and the only known damage-inducing factor C. albicans produces, it is also logical that the host targets candidalysin to prevent its activity. As such, albumin and heparin were recently identified as two host proteins that can neutralize candidalysin activity through hydrophobic interactions (92, 93). Furthermore, a recent study identified sulfated glycosaminoglycans (GAGs) on epithelial cells as critical targets of candidalysin (94). Disruption of specific genes involved in GAG biosynthesis conferred resistance to candidalysin-induced damage, and the use of GAG analogues like dextran sulfate was shown to protect cells and reduce tissue damage and inflammation in murine models of vulvovaginal candidiasis.

Additionally, a recent study employing global fungal-host interactome mapping identified host protein cyclin H as a direct binding partner of candidalysin (95). This interaction activates the cyclin-dependent kinase-activating kinase, inhibiting the DNA damage repair pathway, thereby contributing to host cell damage during infection.

CANDIDALYSIN AS A HEMOLYTIC FACTOR

Numerous studies dating back to the 1950s have shown that C. albicans displays hemolytic activity (9699). Red blood cells represent a rich iron reservoir for C. albicans, which faces substantial iron limitation during systemic infection (100, 101). Notably, C. albicans has developed a specialized pathway for acquiring heme and iron from hemoglobin, a process that is limited to its hyphal morphology (98, 102). Initially, the hemolytic factor was believed to be a sugar moiety of a fungal mannoprotein; however, the precise identity of this factor and the molecular mechanism underlying hemolysis were only recently elucidated (99, 103). It was demonstrated that candidalysin was responsible for inducing red blood cell lysis, as C. albicans ece1∆/∆ and ece1Δ/Δ + ECE1Δ184–279 mutant strains were unable to trigger this effect (103).

CANDIDALYSIN IN IRON AND ZINC ACQUISITION

During tissue invasion and systemic infection, the host limits the availability of essential micronutrients, such as iron and zinc (100, 101, 104). To counteract these restrictions, C. albicans has developed a range of mechanisms to acquire vital micronutrients from host sources. For iron acquisition, the fungal adhesin and invasin Als3p binds to host ferritin, the primary epithelial iron storage protein, providing a critical iron source during epithelial cell invasion (105). Zinc availability is tightly regulated by the host during mucosal and systemic infection, with extracellular zinc depletion mediated by calprotectin, a host-derived zinc-binding protein (106). In response to zinc limitation, C. albicans activates a transcriptional zinc-starvation response, upregulating genes, such as ZRT101 (encoding the cell-surface zinc importer Zrt101p) and PRA1 (encoding the zinc-binding protein Pra1p), which are components of a so-called zincophore system (107).

Interestingly, zinc limitation and the resulting production of Pra1p may also be directly associated with the progression of VVC (108). Likewise, zinc deficiency is a significant risk factor for the development of systemic C. albicans infection in pediatric intensive care unit patients, with zinc supplementation being a recommended prophylaxis (109, 110).

In vitro studies have found that deletion of zinc acquisition genes, such as ZRT101 and ZRT2, significantly reduces host-cell damage, which can be rescued by the exogenous addition of zinc. Notably, C. albicans exhibits a pronounced transcriptional zinc starvation response during in vitro growth, which is mitigated in the presence of intestinal epithelial cells, suggesting that the host cells serve as the primary zinc source during epithelial invasion (111). Deletion of the ECE1 gene results in a marked increase in the transcriptional zinc starvation response in the presence of host cells, indicating that candidalysin-mediated host-cell membrane lysis is required to access intracellular zinc reservoirs. These findings highlight candidalysin as a vital factor enabling C. albicans to access host-derived micronutrients, thereby promoting fungal growth and driving pathogenicity. The interconnected regulation of fungal growth, candidalysin production, and zinc acquisition mechanisms may represent an example of predictive adaptation (112). In this process, the fungus upregulates zinc acquisition genes during hyphal formation, thus preparing for access to host-derived nutrients following cell invasion and candidalysin-induced damage.

CANDIDALYSINS IN DIFFERENT SPECIES

Candidalysin was originally identified in the C. albicans strain SC5314 (13). Recently, a study identified orthologs of the ECE1 gene and candidalysin in the pathogenic Candida species C. dubliniensis and C. tropicalis, thereby forming the first known family of cytolytic peptide toxins in fungi (113). Like the candidalysin from C. albicans SC5314, those from C. dubliniensis and C. tropicalis are flanked by lysine-arginine processing sites. Despite variations in amino acid sequence, all candidalysins share a conserved α-helical secondary structure and amphipathic properties. Interestingly, application of candidalysins from C. dubliniensis and C. tropicalis onto oral epithelial cells revealed significantly higher potency compared to C. albicans, inducing greater levels of cellular damage, calcium influx, and MAPK signaling (113). Additionally, candidalysins from C. dubliniensis and C. tropicalis were observed to permeabilize artificial planar lipid bilayers more rapidly than C. albicans candidalysin (113). Interestingly, despite this enhanced potency, C. dubliniensis and C. tropicalis exhibit reduced pathogenicity, which is likely attributed to their limited level of hypha formation and reduced ECE1 expression. Notably, placing C. dubliniensis and C. tropicalis ECE1 genes under the control of the ECE1 promoter in C. albicans failed to induce epithelial cellular damage (113), highlighting the importance of additional regulatory factors in controlling ECE1 expression, transcript stability, translation, folding, Ece1 processing, and secretion (89).

In addition to candidalysins identified in other Candida species, numerous candidalysin sequence variants have been identified within C. albicans (40, 114, 115) and in isolates of C. dubliniensis and C. tropicalis (115). Biophysical and biological characterization of these variants revealed differences in toxin potency and ability to activate host responses in comparison to their species-specific reference toxins (115). These findings highlight the critical role of specific amino acid residues in candidalysin activity.

BEYOND CANDIDALYSIN: FUNCTIONAL INSIGHTS INTO NON-CANDIDALYSIN ECE1 PEPTIDES (NCEPS)

Most cell-damaging peptide toxins in biology are expressed as precursors. While candidalysin has similarities with other pore-forming peptide toxins, such as bee venom melittin (116), or phenol-soluble modulins of Staphylococci (117), the precursor structure of candidalysin is unusual. After translation, candidalysin is embedded within the polyprotein precursor Ece1p. This pre-pro-protein structure does not resemble the usual precursor of microbial peptide toxins (89). As discussed previously, it consists of a signal peptide, the precursor peptide of candidalysin (P3 in Fig. 1), and seven further non-candidalysin Ece1p peptides (NCEPs), each separated by lysine-arginine (KR) residues. Interestingly, a structurally similar yet unrelated polyprotein has been identified in the plant pathogenic fungus Ustilago maydis, containing several amphipathic peptides that function as hydrophobins (118). In Ece1p, the KR residues serve as processing sites for the Golgi-located proteases, Kex1p and Kex2p. Accurate kexin-mediated cleavage of Ece1p and the subsequent secretion of candidalysin into the extracellular space are critical for hyphal-driven epithelial damage (39). Interestingly, the pre-pro-protein structure is highly conserved among clinical isolates of C. albicans (89), suggesting that NCEPs play an important role in candidalysin delivery and C. albicans biology.

Numerous secreted proteins and peptides of eukaryotic cells are translated as precursors that require post-translational proteolysis by specific proteases. In many cases, removal of an N-terminal pro-domain is sufficient to activate the corresponding effector protein or peptide. This is also true for the production of many microbial pore-forming toxins (119121). In these cases, a precursor is first produced and then processed to prevent self-toxicity. Based on the multiple examples of such precursors, it was initially hypothesized that the function of NCEPs might be to prevent self-toxicity in the fungus (89). However, C. albicans cells are not susceptible to candidalysin, and while the toxin integrates into artificial and human membranes, it does not integrate into C. albicans membranes. Moreover, single adjacent NCEPs that are fused to candidalysin are sufficient to prevent epithelial cell damage. Thus, the primary function of NCEPs and the Ece1p structure are not to prevent self-toxicity.

Conversely, it was shown that NCEPs are crucial for intracellular Ece1p folding and candidalysin secretion (89). The removal of multiple or single NCEPs or modifications to single peptide sequences caused an unfolded protein response, which in turn inhibited hyphal growth, epithelial invasion, and damage. This effect can be attributed to the extreme hydrophobicity of the candidalysin sequences, highlighting the necessity of shielding these sequences with NCEPs to prevent intracellular aggregation. Therefore, the Ece1p precursor is not required to block premature pore-forming toxicity but rather to prevent intracellular auto-aggregation of candidalysin sequences and guide the toxin through the secretory pathway, ensuring its controlled secretion into the extracellular space (89). It is likely that NCEPs are associated with the peptide toxin not only along the secretory pathway but also after its secretion to avoid extracellular aggregation and modulate its function (89). Indeed, the addition of synthetic NCEPs to synthetic candidalysin alters its properties and membrane integration dynamics. While NCEPs are not able to cause hemolysis alone, they still serve a function during hemolysis in vivo. Other NCEPs, particularly P7 and its derivative sub-fragment, are abundant in C. albicans supernatants (13, 39). Interestingly, derivative peptide fragments of P7 were able to increase the hemolytic activity of synthetic candidalysin, though the effect was modest (103). This suggests that while candidalysin is the only major hemolytic factor in C. albicans, P7 and other NCEPs might modulate its activities. Together, these data indicate that studies utilizing synthetic candidalysin may not entirely reflect the in vivo properties of the toxin.

CANDIDALYSIN AS A THERAPEUTIC TARGET

Targeting candidalysin for therapeutic intervention offers a promising strategy to mitigate C. albicans infections without relying on traditional antifungals, which often leads to resistance. Neutralizing candidalysin activity has emerged as a potential therapeutic approach to prevent host cell damage and inflammation. For instance, the purinergic receptor antagonist pyridoxal-phosphate-6-azophenyl-2′,4′-disulfonic acid has been shown to reduce candidalysin-induced hemolysis by inhibiting its intercalation into synthetic membranes (103). Additionally, a llama-derived anti-candidalysin nanobody efficiently neutralized candidalysin-induced lysis of epithelial cells and significantly reduced tissue damage and inflammation in vitro. This nanobody-based approach could complement antifungal treatments like fluconazole to manage VVC symptoms and severity (66). Another promising avenue is the development of vaccines targeting candidalysin, designed to elicit protective immune responses akin to the NDV-3A vaccine, which targets Als3p (122124). Furthermore, targeting candidalysin together with other recognized virulence factors, including adhesins and hydrolytic enzymes, may prove a useful combination therapy against C. albicans infections. However, it should be noted that candidalysin functions as both a virulence and avirulence factor, simultaneously causing cell damage while also inducing the recruitment of immune cells necessary for fungal clearance (16). This dual role underscores the challenge of targeting candidalysin therapeutically without compromising essential immune responses.

CONCLUSION AND FUTURE PERSPECTIVES

Fungal infections are on the rise; they affect more than 1 billion people worldwide and kill 3.8 million people per year (1, 3). During the coronavirus disease 2019 (COVID-19) pandemic, we also witnessed the emergence of COVID-19-associated fungal infections, such as pulmonary aspergillosis and mucormycosis (125127). COVID-19-associated candidiasis caused mainly by C. albicans and C. auris was the main COVID-19-associated fungal infection (126). A study spanning 2020–2021 in the United States revealed that critically ill hospitalized COVID-19 patients with fungal coinfections had a significantly higher mortality rate than patients with non-COVID-19 associated fungal infections (48.5% versus 12.3%, respectively) (127). These numbers highlight the importance of improving the surveillance, prevention, diagnosis, and treatment of fungal infections. In 2022, the World Health Organization published the first report on fungal priority pathogens. The report aims to guide research, development, and public health action and includes C. albicans in the “critical” pathogen group (highest), alongside C. auris, Aspergillus fumigatus, and Cryptococcus neoformans. The number of fungal infections is increasing, and no clinically approved vaccines are available against any fungal pathogen. Therefore, studying fungal infections is a moral imperative for this next decade.

Candidalysin plays a central role in the pathogenicity of C. albicans, acting as a multifaceted toxin that drives host cell damage and orchestrates complex immune responses. By damaging and activating host cells, such as epithelial cells, macrophages, and neutrophils, candidalysin contributes to fungal virulence and host defense, highlighting its dual role in host-pathogen interactions. Furthermore, its involvement in nutrient acquisition underscores its importance in supporting fungal growth and proliferation during infection. Only recently, it was observed that candidalysin is also a crucial commensal factor during gut colonization (128). Understanding the biology and activity of candidalysin is crucial to obtaining valuable insights into C. albicans pathogenesis and may open new avenues for therapeutic interventions targeting this critical virulence attribute.

ACKNOWLEDGMENTS

Data included in this review were supported by grants from the Wellcome Trust (214229_Z_18_Z) and National Institutes of Health (DE022550) to J.R.N. and the Deutsche Forschungsgemeinschaft (DFG; German Research Foundation) Priority Program 2225 Exit Strategies of extracellular pathogens to J.S. and B.H.; the DFG through the Collaborative Research Center (CRC)/Transregio 124 "FungiNet" Project C1 to J.L.S. and B.H. and C2 to B.H.; the DFG within the Cluster of Excellence “Balance of the Microverse” under Germany’s Excellence Strategy–EXC 2051–Project-ID: 467 390713860 and the DFG Project Hu 528/20-1; the German Federal Ministry of Education and Research (BMBF) within the funding program Photonics Research Germany, Leibniz Center for Photonics in Infection Research (LPI), subproject LPI-BT4, contract number 13N15714; and the Leibniz Association Campus InfectoOptics SAS-2015-HKI-LWC to B.H.

Contributor Information

Léa Lortal, Email: lea.lortal@kcl.ac.uk.

Marcio Rodrigues, Instituto Carlos Chagas, Curitiba, Brazil.

REFERENCES

  • 1. Bongomin F, Gago S, Oladele RO, Denning DW. 2017. Global and multi-national prevalence of fungal diseases—estimate precision. J Fungi (Basel) 3:57. doi: 10.3390/jof3040057 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2. Denning DW. 2024. Global incidence and mortality of severe fungal disease. Lancet Infect Dis 24:e428–e438. doi: 10.1016/S1473-3099(23)00692-8 [DOI] [PubMed] [Google Scholar]
  • 3. Kainz K, Bauer MA, Madeo F, Carmona-Gutierrez D. 2020. Fungal infections in humans: the silent crisis. Microb Cell 7:143–145. doi: 10.15698/mic2020.06.718 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4. Akpan A, Morgan R. 2002. Oral candidiasis. Postgrad Med J 78:455–459. doi: 10.1136/pmj.78.922.455 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5. Neville BA, d’Enfert C, Bougnoux M-E. 2015. Candida albicans commensalism in the gastrointestinal tract. FEMS Yeast Res 15:fov081. doi: 10.1093/femsyr/fov081 [DOI] [PubMed] [Google Scholar]
  • 6. Nobile CJ, Johnson AD. 2015. Candida albicans biofilms and human disease. Annu Rev Microbiol 69:71–92. doi: 10.1146/annurev-micro-091014-104330 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7. Gonçalves B, Ferreira C, Alves CT, Henriques M, Azeredo J, Silva S. 2016. Vulvovaginal candidiasis: epidemiology, microbiology and risk factors. Crit Rev Microbiol 42:905–927. doi: 10.3109/1040841X.2015.1091805 [DOI] [PubMed] [Google Scholar]
  • 8. Willems HME, Ahmed SS, Liu J, Xu Z, Peters BM. 2020. Vulvovaginal candidiasis: a current understanding and burning questions. J Fungi (Basel) 6:27. doi: 10.3390/jof6010027 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9. Denning DW, Kneale M, Sobel JD, Rautemaa-Richardson R. 2018. Global burden of recurrent vulvovaginal candidiasis: a systematic review. Lancet Infect Dis 18:e339–e347. doi: 10.1016/S1473-3099(18)30103-8 [DOI] [PubMed] [Google Scholar]
  • 10. Yapar N. 2014. Epidemiology and risk factors for invasive candidiasis. Ther Clin Risk Manag 10:95–105. doi: 10.2147/TCRM.S40160 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11. Mayer FL, Wilson D, Hube B. 2013. Candida albicans pathogenicity mechanisms. Virulence 4:119–128. doi: 10.4161/viru.22913 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12. da Silva Dantas A, Lee KK, Raziunaite I, Schaefer K, Wagener J, Yadav B, Gow NA. 2016. Cell biology of Candida albicans–host interactions. Curr Opin Microbiol 34:111–118. doi: 10.1016/j.mib.2016.08.006 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13. Moyes DL, Wilson D, Richardson JP, Mogavero S, Tang SX, Wernecke J, Höfs S, Gratacap RL, Robbins J, Runglall M, et al. 2016. Candidalysin is a fungal peptide toxin critical for mucosal infection. Nature 532:64–68. doi: 10.1038/nature17625 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14. Naglik JR, Gaffen SL, Hube B. 2019. Candidalysin: discovery and function in Candida albicans infections. Curr Opin Microbiol 52:100–109. doi: 10.1016/j.mib.2019.06.002 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15. Naglik JR, König A, Hube B, Gaffen SL. 2017. Candida albicans–epithelial interactions and induction of mucosal innate immunity. Curr Opin Microbiol 40:104–112. doi: 10.1016/j.mib.2017.10.030 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16. König A, Hube B, Kasper L. 2020. The dual function of the fungal toxin candidalysin during Candida albicans—macrophage interaction and virulence. Toxins (Basel) 12:469. doi: 10.3390/toxins12080469 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17. Engku Nasrullah Satiman EAF, Ahmad H, Ramzi AB, Abdul Wahab R, Kaderi MA, Wan Harun WHA, Dashper S, McCullough M, Arzmi MH. 2020. The role of Candida albicans candidalysin ECE1 gene in oral carcinogenesis. J Oral Pathol Med 49:835–841. doi: 10.1111/jop.13014 [DOI] [PubMed] [Google Scholar]
  • 18. Pellon A, Sadeghi Nasab SD, Moyes DL. 2020. New insights in Candida albicans innate immunity at the mucosa: toxins, epithelium, metabolism, and beyond. Front Cell Infect Microbiol 10:81. doi: 10.3389/fcimb.2020.00081 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19. Ho J, Camilli G, Griffiths JS, Richardson JP, Kichik N, Naglik JR. 2021. Candida albicans and candidalysin in inflammatory disorders and cancer. Immunology 162:11–16. doi: 10.1111/imm.13255 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20. Thompson DS, Carlisle PL, Kadosh D. 2011. Coevolution of morphology and virulence in Candida species. Eukaryot Cell 10:1173–1182. doi: 10.1128/EC.05085-11 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21. Lo H-J, Köhler JR, DiDomenico B, Loebenberg D, Cacciapuoti A, Fink GR. 1997. Nonfilamentous C. albicans mutants are avirulent. Cell 90:939–949. doi: 10.1016/S0092-8674(00)80358-X [DOI] [PubMed] [Google Scholar]
  • 22. Moyes DL, Naglik JR. 2011. Mucosal immunity and Candida albicans infection. Clin Dev Immunol 2011:346307. doi: 10.1155/2011/346307 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23. Nikou S-A, Kichik N, Brown R, Ponde NO, Ho J, Naglik JR, Richardson JP. 2019. Candida albicans interactions with mucosal surfaces during health and disease. Pathogens 8:53. doi: 10.3390/pathogens8020053 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24. Ponde NO, Lortal L, Ramage G, Naglik JR, Richardson JP. 2021. Candida albicans biofilms and polymicrobial interactions. Crit Rev Microbiol 47:91–111. doi: 10.1080/1040841X.2020.1843400 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25. Soll DR. 2024. White-opaque switching in Candida albicans: cell biology, regulation, and function. Microbiol Mol Biol Rev 88:e00043-22. doi: 10.1128/mmbr.00043-22 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26. Sudbery P, Gow N, Berman J. 2004. The distinct morphogenic states of Candida albicans. Trends Microbiol 12:317–324. doi: 10.1016/j.tim.2004.05.008 [DOI] [PubMed] [Google Scholar]
  • 27. Sudbery PE. 2011. Growth of Candida albicans hyphae. Nat Rev Microbiol 9:737–748. doi: 10.1038/nrmicro2636 [DOI] [PubMed] [Google Scholar]
  • 28. Noble SM, Gianetti BA, Witchley JN. 2017. Candida albicans cell-type switching and functional plasticity in the mammalian host. Nat Rev Microbiol 15:96–108. doi: 10.1038/nrmicro.2016.157 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29. Kornitzer D. 2019. Regulation of Candida albicans hyphal morphogenesis by endogenous signals. J Fungi 5:21. doi: 10.3390/jof5010021 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30. Chen H, Zhou X, Ren B, Cheng L. 2020. The regulation of hyphae growth in Candida albicans. Virulence 11:337–348. doi: 10.1080/21505594.2020.1748930 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31. Villa S, Hamideh M, Weinstock A, Qasim MN, Hazbun TR, Sellam A, Hernday AD, Thangamani S. 2020. Transcriptional control of hyphal morphogenesis in Candida albicans. FEMS Yeast Res 20:foaa005. doi: 10.1093/femsyr/foaa005 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32. Chow EWL, Pang LM, Wang Y. 2021. From Jekyll to Hyde: the yeast–hyphal transition of Candida albicans. Pathogens 10:859. doi: 10.3390/pathogens10070859 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33. Martin R, Albrecht-Eckardt D, Brunke S, Hube B, Hünniger K, Kurzai O. 2013. A core filamentation response network in Candida albicans is restricted to eight genes. PLoS One 8:e58613. doi: 10.1371/journal.pone.0058613 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34. Garbe E, Gerwien F, Driesch D, Müller T, Böttcher B, Gräler M, Vylkova S. 2022. Systematic metabolic profiling identifies de novo sphingolipid synthesis as hypha associated and essential for Candida albicans filamentation. mSystems 7:e00539-22. doi: 10.1128/msystems.00539-22 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35. Birse CE, Irwin MY, Fonzi WA, Sypherd PS. 1993. Cloning and characterization of ECE1, a gene expressed in association with cell elongation of the dimorphic pathogen Candida albicans. Infect Immun 61:3648–3655. doi: 10.1128/iai.61.9.3648-3655.1993 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36. Garbe E, Thielemann N, Hohner S, Kumar A, Vylkova S, Kurzai O, Martin R. 2023. Functional analysis of the Candida albicans ECE1 promoter. Microbiol Spectr 11:e00253-23. doi: 10.1128/spectrum.00253-23 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37. Ruben S, Garbe E, Mogavero S, Albrecht-Eckardt D, Hellwig D, Häder A, Krüger T, Gerth K, Jacobsen ID, Elshafee O, Brunke S, Hünniger K, Kniemeyer O, Brakhage AA, Morschhäuser J, Hube B, Vylkova S, Kurzai O, Martin R. 2020. Ahr1 and Tup1 contribute to the transcriptional control of virulence-associated genes in Candida albicans. mBio 11:e00206-20. doi: 10.1128/mBio.00206-20 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38. Bader O, Krauke Y, Hube B. 2008. Processing of predicted substrates of fungal Kex2 proteinases from Candida albicans, C. glabrata, Saccharomyces cerevisiae and Pichia pastoris. BMC Microbiol 8:116. doi: 10.1186/1471-2180-8-116 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39. Richardson JP, Mogavero S, Moyes DL, Blagojevic M, Krüger T, Verma AH, Coleman BM, De La Cruz Diaz J, Schulz D, Ponde NO, Carrano G, Kniemeyer O, Wilson D, Bader O, Enoiu SI, Ho J, Kichik N, Gaffen SL, Hube B, Naglik JR. 2018. Processing of Candida albicans Ece1p is critical for candidalysin maturation and fungal virulence. mBio 9:e02178-17. doi: 10.1128/mBio.02178-17 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40. Liu J, Willems HME, Sansevere EA, Allert S, Barker KS, Lowes DJ, Dixson AC, Xu Z, Miao J, DeJarnette C, Tournu H, Palmer GE, Richardson JP, Barrera FN, Hube B, Naglik JR, Peters BM. 2021. A variant ECE1 allele contributes to reduced pathogenicity of Candida albicans during vulvovaginal candidiasis. PLoS Pathog 17:e1009884. doi: 10.1371/journal.ppat.1009884 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41. Russell CM, Schaefer KG, Dixson A, Gray ALH, Pyron RJ, Alves DS, Moore N, Conley EA, Schuck RJ, White TA, Do TD, King GM, Barrera FN. 2022. The Candida albicans virulence factor candidalysin polymerizes in solution to form membrane pores and damage epithelial cells. Elife 11:e75490. doi: 10.7554/eLife.75490 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42. Calderone RA, Fonzi WA. 2001. Virulence factors of Candida albicans. Trends Microbiol 9:327–335. doi: 10.1016/s0966-842x(01)02094-7 [DOI] [PubMed] [Google Scholar]
  • 43. Hoyer LL, Payne TL, Bell M, Myers AM, Scherer S. 1998. Candida albicans ALS3 and insights into the nature of the ALS gene family. Curr Genet 33:451–459. doi: 10.1007/s002940050359 [DOI] [PubMed] [Google Scholar]
  • 44. Staab JF, Bradway SD, Fidel PL, Sundstrom P. 1999. Adhesive and mammalian transglutaminase substrate properties of Candida albicans Hwp1. Science 283:1535–1538. doi: 10.1126/science.283.5407.1535 [DOI] [PubMed] [Google Scholar]
  • 45. Phan QT, Myers CL, Fu Y, Sheppard DC, Yeaman MR, Welch WH, Ibrahim AS, Edwards JE, Filler SG. 2007. Als3 is a Candida albicans invasin that binds to cadherins and induces endocytosis by host cells. PLoS Biol 5:e64. doi: 10.1371/journal.pbio.0050064 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46. Moyes DL, Richardson JP, Naglik JR. 2015. Candida albicans-epithelial interactions and pathogenicity mechanisms: scratching the surface. Virulence 6:338–346. doi: 10.1080/21505594.2015.1012981 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47. Dalle F, Wächtler B, L’Ollivier C, Holland G, Bannert N, Wilson D, Labruère C, Bonnin A, Hube B. 2010. Cellular interactions of Candida albicans with human oral epithelial cells and enterocytes. Cell Microbiol 12:248–271. doi: 10.1111/j.1462-5822.2009.01394.x [DOI] [PubMed] [Google Scholar]
  • 48. Wächtler B, Citiulo F, Jablonowski N, Förster S, Dalle F, Schaller M, Wilson D, Hube B. 2012. Candida albicans-epithelial interactions: dissecting the roles of active penetration, induced endocytosis and host factors on the infection process. PLoS One 7:e36952. doi: 10.1371/journal.pone.0036952 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49. Naglik JR, Challacombe SJ, Hube B. 2003. Candida albicans secreted aspartyl proteinases in virulence and pathogenesis. Microbiol Mol Biol Rev 67:400–428. doi: 10.1128/MMBR.67.3.400-428.2003 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50. Liu Y, Filler SG. 2011. Candida albicans Als3, a multifunctional adhesin and invasin. Eukaryot Cell 10:168–173. doi: 10.1128/EC.00279-10 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51. Zhu W, Phan QT, Boontheung P, Solis NV, Loo JA, Filler SG. 2012. EGFR and HER2 receptor kinase signaling mediate epithelial cell invasion by Candida albicans during oropharyngeal infection. Proc Natl Acad Sci U S A 109:14194–14199. doi: 10.1073/pnas.1117676109 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52. Mogavero S, Sauer FM, Brunke S, Allert S, Schulz D, Wisgott S, Jablonowski N, Elshafee O, Krüger T, Kniemeyer O, Brakhage AA, Naglik JR, Dolk E, Hube B. 2021. Candidalysin delivery to the invasion pocket is critical for host epithelial damage induced by Candida albicans. Cell Microbiol 23:e13378. doi: 10.1111/cmi.13378 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53. Ho J, Wickramasinghe DN, Nikou S-A, Hube B, Richardson JP, Naglik JR. 2020. Candidalysin is a potent trigger of alarmin and antimicrobial peptide release in epithelial cells. Cells 9:699. doi: 10.3390/cells9030699 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54. Blagojevic M, Camilli G, Maxson M, Hube B, Moyes DL, Richardson JP, Naglik JR. 2021. Candidalysin triggers epithelial cellular stresses that induce necrotic death. Cell Microbiol 23:e13371. doi: 10.1111/cmi.13371 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55. Ho J, Yang X, Nikou S-A, Kichik N, Donkin A, Ponde NO, Richardson JP, Gratacap RL, Archambault LS, Zwirner CP, Murciano C, Henley-Smith R, Thavaraj S, Tynan CJ, Gaffen SL, Hube B, Wheeler RT, Moyes DL, Naglik JR. 2019. Candidalysin activates innate epithelial immune responses via epidermal growth factor receptor. Nat Commun 10:2297. doi: 10.1038/s41467-019-09915-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56. Westman J, Plumb J, Licht A, Yang M, Allert S, Naglik JR, Hube B, Grinstein S, Maxson ME. 2022. Calcium-dependent ESCRT recruitment and lysosome exocytosis maintain epithelial integrity during Candida albicans invasion. Cell Rep 38:110187. doi: 10.1016/j.celrep.2021.110187 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57. Moyes DL, Runglall M, Murciano C, Shen C, Nayar D, Thavaraj S, Kohli A, Islam A, Mora-Montes H, Challacombe SJ, Naglik JR. 2010. A biphasic innate immune MAPK response discriminates between the yeast and hyphal forms of Candida albicans in epithelial cells. Cell Host Microbe 8:225–235. doi: 10.1016/j.chom.2010.08.002 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58. Moyes DL, Murciano C, Runglall M, Islam A, Thavaraj S, Naglik JR. 2011. Candida albicans yeast and hyphae are discriminated by MAPK signaling in vaginal epithelial cells. PLoS One 6:e26580. doi: 10.1371/journal.pone.0026580 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59. Nikou S-A, Zhou C, Griffiths JS, Kotowicz NK, Coleman BM, Green MJ, Moyes DL, Gaffen SL, Naglik JR, Parker PJ. 2022. The Candida albicans toxin candidalysin mediates distinct epithelial inflammatory responses through p38 and EGFR-ERK pathways. Sci Signal 15:eabj6915. doi: 10.1126/scisignal.abj6915 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 60. Verma AH, Richardson JP, Zhou C, Coleman BM, Moyes DL, Ho J, Huppler AR, Ramani K, McGeachy MJ, Mufazalov IA, Waisman A, Kane LP, Biswas PS, Hube B, Naglik JR, Gaffen SL. 2017. Oral epithelial cells orchestrate innate type 17 responses to Candida albicans through the virulence factor candidalysin. Sci Immunol 2:eaam8834. doi: 10.1126/sciimmunol.aam8834 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61. Hanaoka M, Domae E. 2021. IL-1α released from oral epithelial cells upon candidalysin exposure initiates an early innate epithelial response. Int Immunol 33:161–170. doi: 10.1093/intimm/dxaa070 [DOI] [PubMed] [Google Scholar]
  • 62. Ponde NO, Lortal L, Tsavou A, Hepworth OW, Wickramasinghe DN, Ho J, Richardson JP, Moyes DL, Gaffen SL, Naglik JR. 2022. Receptor-kinase EGFR-MAPK adaptor proteins mediate the epithelial response to Candida albicans via the cytolytic peptide toxin, candidalysin. J Biol Chem 298:102419. doi: 10.1016/j.jbc.2022.102419 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63. Swidergall M, Solis NV, Millet N, Huang MY, Lin J, Phan QT, Lazarus MD, Wang Z, Yeaman MR, Mitchell AP, Filler SG. 2021. Activation of EphA2-EGFR signaling in oral epithelial cells by Candida albicans virulence factors. PLoS Pathog 17:e1009221. doi: 10.1371/journal.ppat.1009221 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64. Zhong H, Lu R-Y, Wang Y. 2022. Neutrophil extracellular traps in fungal infections: a seesaw battle in hosts. Front Immunol 13:977493. doi: 10.3389/fimmu.2022.977493 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65. Richardson JP, Willems HME, Moyes DL, Shoaie S, Barker KS, Tan SL, Palmer GE, Hube B, Naglik JR, Peters BM. 2018. Candidalysin drives epithelial signaling, neutrophil recruitment, and immunopathology at the vaginal mucosa. Infect Immun 86:e00645-17. doi: 10.1128/IAI.00645-17 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66. Valentine M, Rudolph P, Dietschmann A, Tsavou A, Mogavero S, Lee S, Priest EL, Zhurgenbayeva G, Jablonowski N, Timme S, Eggeling C, Allert S, Dolk E, Naglik JR, Figge MT, Gresnigt MS, Hube B. 2024. Nanobody-mediated neutralization of candidalysin prevents epithelial damage and inflammatory responses that drive vulvovaginal candidiasis pathogenesis. mBio 15:e03409-23. doi: 10.1128/mbio.03409-23 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67. Lionakis MS, Drummond RA, Hohl TM. 2023. Immune responses to human fungal pathogens and therapeutic prospects. Nat Rev Immunol 23:433–452. doi: 10.1038/s41577-022-00826-w [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68. Fidel PL, Barousse M, Espinosa T, Ficarra M, Sturtevant J, Martin DH, Quayle AJ, Dunlap K. 2004. An intravaginal live Candida challenge in humans leads to new hypotheses for the immunopathogenesis of vulvovaginal candidiasis. Infect Immun 72:2939–2946. doi: 10.1128/IAI.72.5.2939-2946.2004 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69. Yano J, Noverr MC, Fidel PL. 2017. Vaginal heparan sulfate linked to neutrophil dysfunction in the acute inflammatory response associated with experimental vulvovaginal candidiasis. mBio 8:e00211-17. doi: 10.1128/mBio.00211-17 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70. Swidergall M, Khalaji M, Solis NV, Moyes DL, Drummond RA, Hube B, Lionakis MS, Murdoch C, Filler SG, Naglik JR. 2019. Candidalysin is required for neutrophil recruitment and virulence during systemic Candida albicans infection. J Infect Dis 220:1477–1488. doi: 10.1093/infdis/jiz322 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71. Drummond RA, Swamydas M, Oikonomou V, Zhai B, Dambuza IM, Schaefer BC, Bohrer AC, Mayer-Barber KD, Lira SA, Iwakura Y, Filler SG, Brown GD, Hube B, Naglik JR, Hohl TM, Lionakis MS. 2019. CARD9+ microglia promote antifungal immunity via IL-1β- and CXCL1-mediated neutrophil recruitment. Nat Immunol 20:559–570. doi: 10.1038/s41590-019-0377-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 72. Wu Y, Du S, Bimler LH, Mauk KE, Lortal L, Kichik N, Griffiths JS, Osicka R, Song L, Polsky K, Kasper L, Sebo P, Weatherhead J, Knight JM, Kheradmand F, Zheng H, Richardson JP, Hube B, Naglik JR, Corry DB. 2023. Toll-like receptor 4 and CD11b expressed on microglia coordinate eradication of Candida albicans cerebral mycosis. Cell Rep 42:113240. doi: 10.1016/j.celrep.2023.113240 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 73. Unger L, Skoluda S, Backman E, Amulic B, Ponce-Garcia FM, Etiaba CN, Yellagunda S, Krüger R, von Bernuth H, Bylund J, Hube B, Naglik JR, Urban CF. 2023. Candida albicans induces neutrophil extracellular traps and leucotoxic hypercitrullination via candidalysin. EMBO Rep 24:e57571. doi: 10.15252/embr.202357571 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74. Brinkmann V, Zychlinsky A. 2012. Neutrophil extracellular traps: is immunity the second function of chromatin? J Cell Biol 198:773–783. doi: 10.1083/jcb.201203170 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75. Wang Y, Li M, Stadler S, Correll S, Li P, Wang D, Hayama R, Leonelli L, Han H, Grigoryev SA, Allis CD, Coonrod SA. 2009. Histone hypercitrullination mediates chromatin decondensation and neutrophil extracellular trap formation. J Cell Biol 184:205–213. doi: 10.1083/jcb.200806072 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76. Guiducci E, Lemberg C, Küng N, Schraner E, Theocharides APA, LeibundGut-Landmann S. 2018. Candida albicans-induced NETosis is independent of peptidylarginine deiminase 4. Front Immunol 9:1573. doi: 10.3389/fimmu.2018.01573 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 77. Tseng K-Y, Huang Y-T, Huang Y-T, Su Y-T, Wang A-N, Weng W-Y, Ke C-L, Yeh Y-C, Wang J-J, Du S-H, Gu Z-Q, Chen W-L, Lin C-H, Tsai Y-H. 2024. Regulation of candidalysin underlies Candida albicans persistence in intravascular catheters by modulating NETosis. PLoS Pathog 20:e1012319. doi: 10.1371/journal.ppat.1012319 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 78. Westman J, Walpole GFW, Kasper L, Xue BY, Elshafee O, Hube B, Grinstein S. 2020. Lysosome fusion maintains phagosome integrity during fungal infection. Cell Host Microbe 28:798–812. doi: 10.1016/j.chom.2020.09.004 [DOI] [PubMed] [Google Scholar]
  • 79. Olivier FAB, Hilsenstein V, Weerasinghe H, Weir A, Hughes S, Crawford S, Vince JE, Hickey MJ, Traven A. 2022. The escape of Candida albicans from macrophages is enabled by the fungal toxin candidalysin and two host cell death pathways. Cell Rep 40:111374. doi: 10.1016/j.celrep.2022.111374 [DOI] [PubMed] [Google Scholar]
  • 80. Kasper L, König A, Koenig P-A, Gresnigt MS, Westman J, Drummond RA, Lionakis MS, Groß O, Ruland J, Naglik JR, Hube B. 2018. The fungal peptide toxin Candidalysin activates the NLRP3 inflammasome and causes cytolysis in mononuclear phagocytes. Nat Commun 9:4260. doi: 10.1038/s41467-018-06607-1 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 81. Banoth B, Tuladhar S, Karki R, Sharma BR, Briard B, Kesavardhana S, Burton A, Kanneganti T-D. 2020. ZBP1 promotes fungi-induced inflammasome activation and pyroptosis, apoptosis, and necroptosis (PANoptosis). J Biol Chem 295:18276–18283. doi: 10.1074/jbc.RA120.015924 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 82. Wellington M, Koselny K, Krysan DJ. 2012. Candida albicans morphogenesis is not required for macrophage interleukin 1β production. mBio 4:e00433-12. doi: 10.1128/mBio.00433-12 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 83. Wellington M, Koselny K, Sutterwala FS, Krysan DJ. 2014. Candida albicans triggers NLRP3-mediated pyroptosis in macrophages. Eukaryot Cell 13:329–340. doi: 10.1128/EC.00336-13 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 84. Uwamahoro N, Verma-Gaur J, Shen H-H, Qu Y, Lewis R, Lu J, Bambery K, Masters SL, Vince JE, Naderer T, Traven A. 2014. The pathogen Candida albicans hijacks pyroptosis for escape from macrophages. mBio 5:e00003-14. doi: 10.1128/mBio.00003-14 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 85. Krysan DJ, Sutterwala FS, Wellington M. 2014. Catching fire: Candida albicans, macrophages, and pyroptosis. PLoS Pathog 10:e1004139. doi: 10.1371/journal.ppat.1004139 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 86. Ding X, Kambara H, Guo R, Kanneganti A, Acosta-Zaldívar M, Li J, Liu F, Bei T, Qi W, Xie X, Han W, Liu N, Zhang C, Zhang X, Yu H, Zhao L, Ma F, Köhler JR, Luo HR. 2021. Inflammasome-mediated GSDMD activation facilitates escape of Candida albicans from macrophages. Nat Commun 12:6699. doi: 10.1038/s41467-021-27034-9 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 87. Rogiers O, Frising UC, Kucharíková S, Jabra-Rizk MA, van Loo G, Van Dijck P, Wullaert A. 2019. Candidalysin crucially contributes to Nlrp3 inflammasome activation by Candida albicans hyphae. mBio 10:e02221-18. doi: 10.1128/mBio.02221-18 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 88. Westman J, Moran G, Mogavero S, Hube B, Grinstein S. 2018. Candida albicans hyphal expansion causes phagosomal membrane damage and luminal alkalinization. mBio 9:e01226-18. doi: 10.1128/mBio.01226-18 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 89. Müller R, König A, Groth S, Zarnowski R, Visser C, Handrianz T, Maufrais C, Krüger T, Himmel M, Lee S, et al. 2024. Secretion of the fungal toxin candidalysin is dependent on conserved precursor peptide sequences. Nat Microbiol 9:669–683. doi: 10.1038/s41564-024-01606-z [DOI] [PubMed] [Google Scholar]
  • 90. Wu Y, Zeng Z, Guo Y, Song L, Weatherhead JE, Huang X, Zeng Y, Bimler L, Chang C-Y, Knight JM, Valladolid C, Sun H, Cruz MA, Hube B, Naglik JR, Luong AU, Kheradmand F, Corry DB. 2021. Candida albicans elicits protective allergic responses via platelet mediated T helper 2 and T helper 17 cell polarization. Immunity 54:2595–2610. doi: 10.1016/j.immuni.2021.08.009 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 91. Launder D, Dillon JT, Wuescher LM, Glanz T, Abdul-Aziz N, Yi EM-C, Naglik JR, Worth RG, Conti HR. 2024. Immunity to pathogenic mucosal C. albicans infections mediated by oral megakaryocytes activated by IL-17 and candidalysin. Mucosal Immunol 17:182–200. doi: 10.1016/j.mucimm.2024.01.003 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 92. Austermeier S, Pekmezović M, Porschitz P, Lee S, Kichik N, Moyes DL, Ho J, Kotowicz NK, Naglik JR, Hube B, Gresnigt MS. 2021. Albumin neutralizes hydrophobic toxins and modulates Candida albicans pathogenicity. mBio 12:e00531-21. doi: 10.1128/mBio.00531-21 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 93. Domae E, Kamada A, Yoshikawa Y, Ikeo T. 2023. Heparin interacts with candidalysin and neutralizes its cytotoxicity to oral epithelial cells. J Oral Biosci 65:206–210. doi: 10.1016/j.job.2023.03.002 [DOI] [PubMed] [Google Scholar]
  • 94. Lin J, Miao J, Schaefer KG, Russell CM, Pyron RJ, Zhang F, Phan QT, Solis NV, Liu H, Tashiro M, Dordick JS, Linhardt RJ, Yeaman MR, King GM, Barrera FN, Peters BM, Filler SG. 2024. Sulfated glycosaminoglycans are host epithelial cell targets of the Candida albicans toxin candidalysin. Nat Microbiol 9:2553–2569. doi: 10.1038/s41564-024-01794-8 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 95. Zhang T-Y, Chen Y-Q, Tan J-C, Zhou J-A, Chen W-N, Jiang T, Zha J-Y, Zeng X-K, Li B-W, Wei L-Q, Zou Y, Zhang L-Y, Hong Y-M, Wang X-L, Zhu R-Z, Xu W-X, Xi J, Wang Q-Q, Pan L, Zhang J, Luan Y, Zhu R-X, Wang H, Chen C, Liu N-N. 2024. Global fungal-host interactome mapping identifies host targets of candidalysin. Nat Commun 15:1757. doi: 10.1038/s41467-024-46141-x [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 96. Salvin SB. 1951. Hemolysin from the yeastlike phases of some pathogenic fungi. Exp Biol Med (Maywood) 76:852–854. doi: 10.3181/00379727-76-18653 [DOI] [PubMed] [Google Scholar]
  • 97. Manns JM, Mosser DM, Buckley HR. 1994. Production of a hemolytic factor by Candida albicans. Infect Immun 62:5154–5156. doi: 10.1128/iai.62.11.5154-5156.1994 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 98. Tanaka WT, Nakao N, Mikami T, Matsumoto T. 1997. Hemoglobin is utilized by Candida albicans in the hyphal form but not yeast form. Biochem Biophys Res Commun 232:350–353. doi: 10.1006/bbrc.1997.6247 [DOI] [PubMed] [Google Scholar]
  • 99. Watanabe T, Takano M, Murakami M, Tanaka H, Matsuhisa A, Nakao N, Mikami T, Suzuki M, Matsumoto T. 1999. Characterization of a haemolytic factor from Candida albicans. Microbiology (Reading, Engl) 145:689–694. doi: 10.1099/13500872-145-3-689 [DOI] [PubMed] [Google Scholar]
  • 100. Hebecker B, Vlaic S, Conrad T, Bauer M, Brunke S, Kapitan M, Linde J, Hube B, Jacobsen ID. 2016. Dual-species transcriptional profiling during systemic candidiasis reveals organ-specific host-pathogen interactions. Sci Rep 6:36055. doi: 10.1038/srep36055 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 101. Solis NV, Wakade RS, Filler SG, Krysan DJ. 2023. Candida albicans oropharyngeal infection is an exception to iron-based nutritional immunity. mBio 14:e00095-23. doi: 10.1128/mbio.00095-23 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 102. Kornitzer D, Roy U. 2020. Pathways of heme utilization in fungi. Biochim Biophys Acta Mol Cell Res 1867:118817. doi: 10.1016/j.bbamcr.2020.118817 [DOI] [PubMed] [Google Scholar]
  • 103. Mogavero S, Höfs S, Lauer AN, Müller R, Brunke S, Allert S, Gerwien F, Groth S, Dolk E, Wilson D, Gutsmann T, Hube B. 2022. Candidalysin is the hemolytic factor of Candida albicans. Toxins (Basel) 14:874. doi: 10.3390/toxins14120874 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 104. Casadevall A, Pirofski L. 2001. Host‐pathogen interactions: the attributes of virulence. J Infect Dis 184:337–344. doi: 10.1086/322044 [DOI] [PubMed] [Google Scholar]
  • 105. Almeida RS, Brunke S, Albrecht A, Thewes S, Laue M, Edwards JE, Filler SG, Hube B. 2008. The hyphal-associated adhesin and invasin Als3 of Candida albicans mediates iron acquisition from host ferritin. PLoS Pathog 4:e1000217. doi: 10.1371/journal.ppat.1000217 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 106. Besold AN, Gilston BA, Radin JN, Ramsoomair C, Culbertson EM, Li CX, Cormack BP, Chazin WJ, Kehl-Fie TE, Culotta VC. 2018. Role of calprotectin in withholding zinc and copper from Candida albicans. Infect Immun 86:e00779-17. doi: 10.1128/IAI.00779-17 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 107. Citiulo F, Jacobsen ID, Miramón P, Schild L, Brunke S, Zipfel P, Brock M, Hube B, Wilson D. 2012. Candida albicans scavenges host zinc via Pra1 during endothelial invasion. PLoS Pathog 8:e1002777. doi: 10.1371/journal.ppat.1002777 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 108. Roselletti E, Pericolini E, Nore A, Takacs P, Kozma B, Sala A, De Seta F, Comar M, Usher J, Brown GD, Wilson D. 2023. Zinc prevents vaginal candidiasis by inhibiting expression of an inflammatory fungal protein. Sci Transl Med 15:eadi3363. doi: 10.1126/scitranslmed.adi3363 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 109. Xie J, Zhu L, Zhu T, Jian Y, Ding Y, Zhou M, Feng X. 2019. Zinc supplementation reduces Candida infections in pediatric intensive care unit: a randomized placebo-controlled clinical trial. J Clin Biochem Nutr 64:170–173. doi: 10.3164/jcbn.18-74 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 110. Fly JH, Kapoor S, Bobo K, Stultz JS. 2022. Updates in the pharmacologic prophylaxis and treatment of invasive candidiasis in the pediatric and neonatal intensive care units: updates in the pharmacologic prophylaxis. Curr Treat Options Infect Dis 14:15–34. doi: 10.1007/s40506-022-00258-z [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 111. Sprague JL, Schille TB, Allert S, Trümper V, Lier A, Großmann P, Priest EL, Tsavou A, Panagiotou G, Naglik JR, Wilson D, Schäuble S, Kasper L, Hube B. 2024. Candida albicans translocation through the intestinal epithelial barrier is promoted by fungal zinc acquisition and limited by NFκB-mediated barrier protection. PLoS Pathog 20:e1012031. doi: 10.1371/journal.ppat.1012031 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 112. Brown AJP, Gow NAR, Warris A, Brown GD. 2019. Memory in fungal pathogens promotes immune evasion, colonisation, and infection. Trends Microbiol 27:219–230. doi: 10.1016/j.tim.2018.11.001 [DOI] [PubMed] [Google Scholar]
  • 113. Richardson JP, Brown R, Kichik N, Lee S, Priest E, Mogavero S, Maufrais C, Wickramasinghe DN, Tsavou A, Kotowicz NK, Hepworth OW, Gallego-Cortés A, Ponde NO, Ho J, Moyes DL, Wilson D, D’Enfert C, Hube B, Naglik JR. 2022. Candidalysins are a new family of cytolytic fungal peptide toxins. mBio 13:e03510-21. doi: 10.1128/mbio.03510-21 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 114. Sala A, Ardizzoni A, Spaggiari L, Vaidya N, van der Schaaf J, Rizzato C, Cermelli C, Mogavero S, Krüger T, Himmel M, Kniemeyer O, Brakhage AA, King BL, Lupetti A, Comar M, de Seta F, Tavanti A, Blasi E, Wheeler RT, Pericolini E. 2023. A new phenotype in Candida-epithelial cell interaction distinguishes colonization- versus vulvovaginal candidiasis-associated strains. mBio 14:e00107-23. doi: 10.1128/mbio.00107-23 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 115. Wickramasinghe DN, Lyon CM, Lee S, Hepworth OW, Priest EL, Maufrais C, Ryan AP, Permal E, Sullivan D, McManus BA, Hube B, Butler G, d’Enfert C, Naglik JR, Richardson JP. 2024. Variations in candidalysin amino acid sequence influence toxicity and host responses. mBio 15:e0335123. doi: 10.1128/mbio.03351-23 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 116. Memariani H, Memariani M. 2020. Anti-fungal properties and mechanisms of melittin. Appl Microbiol Biotechnol 104:6513–6526. doi: 10.1007/s00253-020-10701-0 [DOI] [PubMed] [Google Scholar]
  • 117. Peschel A, Otto M. 2013. Phenol-soluble modulins and staphylococcal infection. Nat Rev Microbiol 11:667–673. doi: 10.1038/nrmicro3110 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 118. Wösten HA, Bohlmann R, Eckerskorn C, Lottspeich F, Bölker M, Kahmann R. 1996. A novel class of small amphipathic peptides affect aerial hyphal growth and surface hydrophobicity in Ustilago maydis. EMBO J 15:4274–4281. doi: 10.1002/j.1460-2075.1996.tb00802.x [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 119. Gonzalez MR, Bischofberger M, Pernot L, van der Goot FG, Frêche B. 2008. Bacterial pore-forming toxins: the (w)hole story? Cell Mol Life Sci 65:493–507. doi: 10.1007/s00018-007-7434-y [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 120. Bischofberger M, Iacovache I, van der Goot FG. 2012. Pathogenic pore-forming proteins: function and host response. Cell Host Microbe 12:266–275. doi: 10.1016/j.chom.2012.08.005 [DOI] [PubMed] [Google Scholar]
  • 121. Peraro MD, van der Goot FG. 2016. Pore-forming toxins: ancient, but never really out of fashion. Nat Rev Microbiol 14:77–92. doi: 10.1038/nrmicro.2015.3 [DOI] [PubMed] [Google Scholar]
  • 122. Edwards JE, Schwartz MM, Schmidt CS, Sobel JD, Nyirjesy P, Schodel F, Marchus E, Lizakowski M, DeMontigny EA, Hoeg J, Holmberg T, Cooke MT, Hoover K, Edwards L, Jacobs M, Sussman S, Augenbraun M, Drusano M, Yeaman MR, Ibrahim AS, Filler SG, Hennessey JP. 2018. A fungal immunotherapeutic vaccine (NDV-3A) for treatment of recurrent vulvovaginal candidiasis—a phase 2 randomized, double-blind, placebo-controlled trial. Clin Infect Dis 66:1928–1936. doi: 10.1093/cid/ciy185 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 123. Schmidt CS, White CJ, Ibrahim AS, Filler SG, Fu Y, Yeaman MR, Edwards JE, Hennessey JP. 2012. NDV-3, a recombinant alum-adjuvanted vaccine for Candida and Staphylococcus aureus, is safe and immunogenic in healthy adults. Vaccine (Auckl) 30:7594–7600. doi: 10.1016/j.vaccine.2012.10.038 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 124. Uppuluri P, Singh S, Alqarihi A, Schmidt CS, Hennessey JP, Yeaman MR, Filler SG, Edwards JE, Ibrahim AS. 2018. Human anti-Als3p antibodies are surrogate markers of NDV-3A vaccine efficacy against recurrent vulvovaginal candidiasis. Front Immunol 9:1349. doi: 10.3389/fimmu.2018.01349 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 125. Hoenigl M, Seidel D, Sprute R, Cunha C, Oliverio M, Goldman GH, Ibrahim AS, Carvalho A. 2022. COVID-19-associated fungal infections. Nat Microbiol 7:1127–1140. doi: 10.1038/s41564-022-01172-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 126. Domán M, Bányai K. 2022. COVID-19-associated fungal infections: an urgent need for alternative therapeutic approach? Front Microbiol 13:919501. doi: 10.3389/fmicb.2022.919501 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 127. Gold JAW, Adjei S, Gundlapalli AV, Huang Y-L, Chiller T, Benedict K, Toda M. 2023. Increased hospitalizations involving fungal infections during COVID-19 pandemic, United States, January 2020–December 2021. Emerg Infect Dis 29:1433–1437. doi: 10.3201/eid2907.221771 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 128. Liang S-H, Sircaik S, Dainis J, Kakade P, Penumutchu S, McDonough LD, Chen Y-H, Frazer C, Schille TB, Allert S, Elshafee O, Hänel M, Mogavero S, Vaishnava S, Cadwell K, Belenky P, Perez JC, Hube B, Ene IV, Bennett RJ. 2024. The hyphal-specific toxin candidalysin promotes fungal gut commensalism. Nature 627:620–627. doi: 10.1038/s41586-024-07142-4 [DOI] [PMC free article] [PubMed] [Google Scholar]

Articles from mBio are provided here courtesy of American Society for Microbiology (ASM)

RESOURCES