Skip to main content
Bioinformatics logoLink to Bioinformatics
. 2025 Jul 15;41(Suppl 1):i401–i409. doi: 10.1093/bioinformatics/btaf189

From high-throughput evaluation to wet-lab studies: advancing mutation effect prediction with a retrieval-enhanced model

Yang Tan 1,2,3,4,, Ruilin Wang 5,, Banghao Wu 6,7,, Liang Hong 8,9,10, Bingxin Zhou 11,12,
PMCID: PMC12261477  PMID: 40662802

Abstract

Motivation

Enzyme engineering is a critical approach for producing enzymes that meet industrial and research demands by modifying wild-type proteins to enhance properties such as catalytic activity and thermostability. Beyond traditional directed evolution and rational design, recent advancements in deep learning offer cost-effective and high-performance alternatives. By encoding implicit coevolutionary patterns, these pretrained models have become powerful tools, with the central challenge being to uncover the intricate relationships among protein sequence, structure, and function.

Results

We present VenusREM, a retrieval-enhanced protein language model designed to capture local amino acid interactions in both spatial and temporal scales. VenusREM achieves state-of-the-art performance on 217 assays from the ProteinGym benchmark. Beyond high-throughput open benchmark validations, we conducted a low-throughput post hoc analysis on more than 30 mutants to verify the model’s ability to improve the stability and binding affinity of a VHH antibody. We also validated the effectiveness of VenusREM by designing 10 novel mutants of a DNA polymerase and performing wet-lab experiments to evaluate their enhanced activity at elevated temperatures. Both in silico and experimental evaluations not only confirm the reliability of VenusREM as a computational tool for enzyme engineering but also demonstrate a comprehensive evaluation framework for future computational studies in mutation effect prediction.

Availability and implementation

The implementation is available at https://github.com/tyang816/VenusREM.

1 Introduction

Enzymes are fundamental components of synthetic biology systems. Wild-type enzymes often face limitations such as low catalytic activity, poor stability, and insufficient binding affinity, which restrict their applications in both academic research and industrial practice (Zhou et al. 2024a). Through enzyme engineering, wild-type proteins can be modified to enhance these properties, enabling them to meet the requirements of specific applications (Lu et al. 2022, Zhou et al. 2024b).

With the rapid expansion of protein databases and continuous advancements in artificial intelligence, deep learning methods offer new possibilities for enzyme engineering. Typically, a deep neural network for proteins is pretrained on large-scale protein sequence data (with optional structural information) to learn to extract numerical representations of proteins, where the resulting embeddings are then used to score and rank candidate mutants (Meier et al. 2021, Notin et al. 2022a, Lin et al. 2023). This prediction task, known as mutation effect prediction, is often evaluated using high-throughput datasets from deep mutation scanning (DMS), e.g. ProteinGym (Notin et al. 2024).

Existing pretraining schemes can be broadly divided into three categories: sequence-based, structure-based, and evolution-based approaches. Sequence-based methods are the most popular choice. They analyze the implicit pairwise relationships between amino acids (AAs) to learn protein sequence representations. The objective of pretraining such a protein language model (PLM) is to predict unknown AA types in a sequence from partial input, typically by autoregressively generating AAs along the sequence index (Notin et al. 2022b, Madani et al. 2023) or by randomly masking a set of AAs and recovering them (Rives et al. 2021, Li et al. 2024). The second category of structure-based methods incorporates topological inductive biases to capture stronger interactions between spatially adjacent AAs (Hsu et al. 2022, Zhou et al. 2024c). Geometric deep learning methods are typically applied to embed these associated structural constraints. The third category introduces multiple sequence alignment (MSA) data into the model to provide evolutionary information about proteins (Notin et al. 2022a, Roshan et al. 2021). MSA reflects protein conservation and the variation patterns occurring through natural evolution. Although lacking explicit functional labels, homologous sequences offer valuable information beyond a single sequence or structure for predicting protein assays.

A natural question that arises when constructing implicit representations for proteins using deep learning is: how can we effectively integrate the nonorthogonal sequence, structure, and evolutionary characteristics? Although some works have considered encoding two types of information simultaneously, such as sequence and MSA information (Roshan et al. 2021) or sequence and structure information (Tan et al. 2023, 2024a, Yang et al. 2023), to the best of our knowledge, no work has yet integrated all three types. Also, when incorporating homology information, existing methods either require additional training procedures (e.g. EVE; Frazer et al. 2021) or lack plug-and-play flexibility (e.g. MSA transformer; Roshan et al. 2021) and PoET; Truong and Bepler 2023; both include evolutionary information with model-specific designs).

Consequently, protein representations learned from pretraining frameworks may lack a piece of crucial features that could significantly impact function. To address this gap, we propose a new pretrained PLM with a Retrieval-Enhanced Module, namely VenusREM (Fig. 1). We design the model to uncover implicit representations of native features based on sequence and structure tokens, where sequence–structure embeddings are integrated through disentangled multihead cross-attention layers trained in a BERT-style manner. The evolutionary representations are determined by an alignment tokenization module without additional training workload and are integrated into the fitness evaluation of mutants in a plug-and-play fashion.

Figure 1.

Figure 1.

Workflow of VenusREM for predicting mutation effects. (a) For a given template protein, VenusREM encodes structural, sequence, and MSA information to generate logits for each residue, which are used to calculate mutation fitness scores. (b) For each AA, its local structure is clustered into 2048 distinct structure tokens. (c) The vector representations of structural and sequence information are integrated using disentangled cross-attention through BERT-style pretraining. (d) Homologous information is retrieved via Jackhmmer and converted to a matrix representation of evolutionary logits.

To validate the effectiveness of VenusREM, we examine two scenarios: (i) Can VenusREM consistently outperform the prediction performance of previous methods across diverse proteins and assays on high-throughput experimental data (which is more comprehensive and contains more records)? (ii) Can VenusREM provide reliable predictions to help biologists identify expected single-site and multisite mutation designs in practice (i.e. low-throughput experiments with more precise quantitative measurements)? To address the first question, we evaluate Spearman’s ρ between predicted mutation fitness and experimental scores on over 2 million mutants from 217 assays in ProteinGym, the largest open benchmark, and compare VenusREM with all models on the public leaderboard. The superior performance of our model across all functions and properties underscores its leading position in general-purpose mutation effect prediction. For the second question, we conduct both in silico analysis on the variable domain of the heavy chain of a nano-antibody targeting growth hormone (VHH antibody) and experimental evaluation on the bacteriophage phi29 DNA polymerase (phi29 DNAP). We discuss the model’s feasibility in enhancing various assays (e.g. stability, activity, and binding affinity) with both single-site and multisites mutations. VenusREM effectively identify positive mutations and rank mutant performance scores, demonstrating significant potential for identifying highly active and stable mutants from the complete search space, thereby providing pivotal support for enhancing properties in enzyme engineering.

2 Materials and methods

This section overviews the development and evaluation of VenusREM. The overall architecture of VenusREM is first introduced to establish a comprehensive understanding of its design principles. Next, we detail the preparation of input data, with a particular emphasis on sequence and structure homology searches. We then describe the computational methods for integrating multimodal information, including the design of the cross-attention module to unify sequence and structural features, and strategies for retrieving and incorporating homologous sequence data. Lastly, we outline the experimental evaluation protocols of both in silico experiments and wet-lab assays.

2.1 Model overview

For a given template protein, VenusREM receives three sets of inputs: sequence, structure, and homolog information (Fig. 1a). The sequence and structure inputs are tokenized and processed by a pretrained PLM to generate a native representation of the single protein (Fig. 1b and c). Simultaneously, homologous family sequences—identified based on sequence and/or structural similarity to the template protein—are summarized and integrated into the model (Fig. 1d). Both the native representation and the evolutionary representations are vectorized descriptions of AA positions and types. These representations are further processed through a specifically defined scoring rule to compute the final mutation fitness score.

2.2 Data preparation

2.2.1 Sequence and structure tokens

We first extract discrete representations of the sequence and structure, which are used as inputs for the PLM to generate vector representations. The sequence input is inherently discrete and can be tokenized directly without additional preprocessing. For the local structure of AAs, we utilize a structure tokenization module, which constructs a codebook with 2048 dimensions to encode structural information effectively. Both sequence and structure tokens will later be sent to disentangled multihead attention to encode native representation.

2.2.1.1 Residue-level sequence tokenization

The construction of sequence tokens is relatively straightforward. We construct a vocabulary for 20 standard AAs and 5 special characters (i.e. <pad> , <cls> , <eos> , <unk>, and <mask>) to encode the AA sequence. Each sequence of L AAs is mapped to a one-hot vector of size L×25. The training set for the pretrained language model is from Foldseek, which clusters the AlphaFold2 database to retain the original PDB structures and AA sequences. For inference, only the characteristics of the wild-type protein (sequence and structure) are required as input for tokenization and homolog sequence retrieval. Unlike other approaches, our method does not rely on mutating each position according to the DMS data (Notin et al. 2022a) or applying mask operations (Su et al. 2023) during input preparation.

2.2.1.2 Local structure tokenization

Following Li et al. (2024) and Tan et al. (2024b), we represent local protein structures by a codebook of discrete structural representations on a per-residue basis. Finding token representations for local protein structures involves two key steps, including local structure extraction and latent structure vocabulary assignment (Fig. 1b). Consider a protein with L AAs. For each residue, we define its local structure by considering up to 40 neighboring residues within a 10 Å spatial radius. We defined an undirected graph with each node representing a residue, and two nodes are connected if their spatial distances are <10 Å. The constructed L graphs are then fed into pretrained geometric vector perceptrons (GVP) (Jing et al. 2021), denote as πθ(G)RL×256. The GVP is integrated with a decoder to form an autoencoder, trained with a denoising pretraining objective by perturbing Cα coordinates with 3D Gaussian noise and applying Brownian motion. We train a six-layer GVP with 4, 735, 677 graphs of local structures from CATH43-S40 (Orengo et al. 1997). After obtaining the matrix representation, a mean pooling operation is then applied to produce the final vector representation of local structures. These 256-dimensional vectors in the continuous space are further mapped to a 2048-dimensional discrete space using K-means clustering for a balance between efficiency and representativeness, where each dimension represents an implicit vocabulary of structures.

2.2.2 Homological sequences

In addition to the sequence- and structure-based native information, VenusREM incorporates evolutionary information retrieved from homologous sequences. We consider three retrieval strategies, each tailored to leverage distinct sources and formats of alignment data.

2.2.2.1 EVcouplings alignment

For each assay in ProteinGym, we utilized the curated MSAs provided by the official source. In cases where domain information was available, alignments were restricted to the domain regions. Homologous sequences were retrieved using Jackhmmer (Eddy 2011), a profile hidden Markov model-based tool, with five iterations and a bit score ranging from 0.1 to 0.9, resulting in nine distinct search groups, with searches performed on the Uniref100 dataset (downloaded on 24 November 2021). Subsequently, the EVcouplings (Hopf et al. 2014) library was employed to select the .a2m file containing the highest number of significant evolutionary couplings among the retrieved alignments. To prepare the final alignment files, lowercase letters in the .a2m files were converted to uppercase, and special characters were replaced with the <pad> token. This preprocessing ensured the alignments were suitable for downstream analyses.

2.2.2.2 ColabFold alignment

The second strategy uses ColabFold (Mirdita et al. 2022) to automate MSA retrieval by querying a local PDB database, which outputs alignments in the .a3m format. Unlike .a2m by EVcouplings, the .a3m format compresses gaps in the query sequence to enhance computational efficiency. It is notable that the .a3m files generated by ColabFold are not fully aligned. To address this, we apply the reformat.pl script to adjust and realign the sequences, which ensures compatibility with downstream analyses. This integrated approach combines automated retrieval and alignment refinement, thus optimizes both computational performance and the accuracy of MSAs.

2.2.2.3 Foldseek alignment

In the third strategy, structural alignment data are retrieved with efficient implementation by the Foldseek API (Van Kempen et al. 2024). Queries could be submitted via HTTP POST requests, targeting multiple protein structure databases, such as afdb50, afdb-proteome, cath50, and pdb100 (detailed in Supplementary Table S3). In short, the pipeline begins with uploading the query structure (.pdb) and monitoring the server response in a loop until the search status is marked as “COMPLETE”. The result ticket is extracted during each iteration, with the .json response parsed to confirm progress. In the event of errors, the system retries after a brief delay. Upon receiving the final results, the alignment data is processed to extract meaningful information. Specifically, the query and target alignments are parsed from the results, with gaps removed from the query sequence and the target sequence adjusted accordingly. To ensure consistency, the final target alignment is padded with gaps to match the length of the query sequence. The processed alignments are then stored in a dictionary, indexed by key target information, including sequence name, probability, evaluation score, and alignment positions.

We tested the three homology searching strategies in this study (Supplementary Table S2). In the case of the 217 assays in ProteinGym, the corresponding .a2m documents used in the first strategy are directly downloaded from https://marks.hms.harvard.edu/proteingym/DMS_msa_files.zip. For the other two search strategies (based on ColabFold and Foldseek), we search for homologous sequences according to the protocol we have introduced above. The additional computational steps for summarizing evolutionary representations from these phonological sequences will be introduced in the next section.

2.3 Model construction

2.3.1 Native representation calculation

The native representation, i.e. the joint embeddings of protein sequences and structures, are obtained by a BERT-style PLM. The core propagation rule is based on disentangled multihead cross-attention (He et al. 2020, Li et al. 2024) (Fig. 1c). For a protein of length L, we define the token inputs for its AA sequence and structure as R and S. For two arbitrary AAs at positions i and j, their attention score Attn(i,j) is calculated based on R, S, and their relative position P:

Attn(i,j)={Ri,Si,Pij}×{Rj,Sj,Pji}, (1)

where Pij represents the relative position from the ith AA to the jth AA. After the element-wise multiplication in (1), We further simplify the equation by discarding terms that do not contain residue information, i.e. SjSj,SiPji,PjiSj,PjiPji, and retain only the five AA-relevant attention scores and rewrite them with the query, key, and value matrices, which are obtained via linear transformations during forward propagation:

Attn(i,j)=RiRj+RiSj+RiPji+SiRj+PijRj=QiR(KjR)+QiR(KjS)+QiR(KjiP)+QiS(KjR)+QijP(KjR). (2)

The notations follows conventional attention. The subscription denotes their association with the AA and the superscription denotes their association to the input, e.g. QiR represents the query value for the ith AA on its sequence information and KijP represents the key value with respect to the relative distance from the ith AA to the jth AA.

Similar to classic attention schemes, the initial attention scores obtained from (Native Representation Calculation) require element-wise normalization by a scaling factor 1/5d with d being the dimension of QR. Denote the unnormalized attention matrix as Hattn. We use it to update the hidden representation for R, which reads:

Ro=σ(Hattn5d)VR, (3)

where σ(·) is a softmax activation function which operates in the last dimension and VR is the value matrix of R.

2.3.2 Evolutionary representation calculation

We process homologous sequences to extract evolutionary representations. For simplicity, we replace the gap character—with a special token <pad>. Suppose N homologous sequences are found for a protein of length L, denoted by AZN×L. A counting matrix CRL×V records the frequencies of AA types at each residue position, where

Civ=n=1NI(Ani=v)v=1Vn=1NI(Ani=v). (4)

The vocabulary size V=25 accounts for 20 AAs and 5 special tokens. The indicator function I(Ani=v) assigns 1 if the ith position (1iL) of the nth sequence (1nN) fills the vth token (1vV), otherwise 0. The final evolutionary logits Oevo are generated from C with subsequent normalization and log-transformation, i.e.

Oivevo=log(exp(Civ)v=1Vexp(Civ)). (5)

2.3.3 Zero-shot fitness scoring

For a given mutant, its fitness score is calculated by comparing the predicted logits of the mutant residues with those of the wild-type residues. We first predict the native logits Oivnative from the pretrained PLM, and combines it with evolutionary logits Oivevo:

Oivout=(1α)·Oivnative+α·Oivevo, (6)

where the retrieval ratio α[0,1] controls the weight of integrating the intrinsic and evolution probability distributions.

The mutation fitness scores are calculated from Oout. For a mutant x, the overall fitness score Fx is obtained by summing the associated logit differences across all mutation sites tT:

Fx=tT(OtvoutOtvout), (7)

where at position t, the mutant alters the residue type from the wild-type v to mutate residue v. This scoring method captures the relative fitness by evaluating how much the mutation alters the predicted logit values compared to the wild type, with larger logit differences reflecting more significant deviations in fitness. For multiple mutations, the logit differences are summed over all mutated sites to reflect the cumulative effect of all alterations.

2.4 In silico evaluation

2.4.1 Baseline methods

On the high-throughput public benchmark dataset ProteinGym, we compared VenusREM against a range of baseline zero-shot protein models, including sequence-based models, sequence-structure models, alignment-based models, and inverse folding models. We selected the top 50 models listed on the ProteinGym leaderboard (https://proteingym.org/benchmarks) as of the submission deadline. For clarity, we chose the best-performing version of each model based on the overall score. All models were evaluated under ProteinGym’s standardized protocol, which includes calculating Spearman’s correlation coefficients and the corresponding standard deviation. All baseline methods are open-sourced with readily available checkpoints for direct implementation (Supplementary Table S1).

For the case study comparisons, we compare the performance of VenusREM with leading sequence-based (ESM2 and ESM-1b) and sequence–structure models (SaProt, ProtSSN, and MIF-ST) to highlight its advantages.

2.4.2 Experimental protocol

The official implementation of VenusREM is at https://github.com/tyang816/VenusREM. The model training and inference are performed on four NVIDIA 3080 GPUs with 10GB VRAM, using PyTorch version 2.4.1. The Transformers library version 4.45.0 is used for the PLM module. We freeze the pretrained parameters for native representation calculation available at https://huggingface.co/AI4Protein/ProSST-2048. Other environment configurations for reproducing the model can be found in the GitHub repository. Homology sequence searches are conducted using the Conda-maintained Jackhmmer and EVcouplings libraries, with an additional plmc dependency required for EVcouplings. We set the optimal setting for the retrieval factor α=0.8.

2.4.3 Benchmark datasets

2.4.3.1 ProteinGym: high-throughput evaluation

ProteinGym is a comprehensive suite of benchmarks designed to evaluate the proficiency of models in forecasting the impacts of protein mutations. These benchmarks are categorized based on the nature of the mutations (substitutions versus indels) and the origin of the ground truth data (DMS assay versus clinical annotation). In our study, we have opted to utilize the substitution mutations to demonstrate the capabilities of our model. This subset encompasses 217 high-throughput assays, totaling more than 2.5 million mutations.

2.4.3.2 VHH antibody: post hoc analysis with existing experimental results

We extracted the experimental data of 31 VHH antibody mutants from Kang et al. (2025), covering 1–4 site mutations for binding affinity and alkali resistance. For both assays, we used the average EC50 values from three repeated experiments. The wild-type VHH antibody sequence is as follows:

MQVQLVESGGGLAQAGGSLRLSCAVSGMPEFARAMGWFRQAPGKERELLAAIEGIGATTYYADSVKGRFTISRDDAANTVLLQMNSLKPDDTAVYYCAAAFSVTIPTRARHWVDWGPGTLVTVSSDDDDKSGGGGSHHHHHH

The corresponding structure is predicted by AlphaFold3 server (Abramson et al. 2024). The homology alignment sequences are searched from UniRef100 database (downloaded in October 2024).

2.5 Wet-lab examination

We followed the same approach as in the previous experiments on the VHH antibody, using VenusREM to evaluate phi29 DNA polymerase’s C3 mutant as the starting point. Single-point saturation mutations were scored, and the top 10 mutants with the highest scores were selected for experimental validation. These experiments assessed the activity and thermostability of the selected mutants compared to the C3 mutant. The sequence of the C3 mutant is provided below:

MKHMPRKRYSCDFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWALKVQADLYFHNLKFDGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKDFKDIITTKKFKKVFPTLSLELDKKVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDKVDPKKLGYWAHESTFKRAKYLRPKTYIQDIYMKEVDGELVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK.

The detailed experimental procedures are provided in the Supplementary Material.

3 Results

This section presents in silico analyses and experimental assessments to comprehensively evaluate the performance of VenusREM across various properties and protein types. The following content highlights VenusREM’s performance on 217 DMS protein assays with over 2 million records. We also extract low-throughput experimental results from previous studies to assess the model’s reliability in predicting multi-site mutants for specific proteins. Additionally, we used VenusREM to engineer phi29 DNAP and experimentally validated the activity and thermostability on 10 single-site mutants.

3.1 VenusREM ranks top on ProteinGym leaderboard with significant performance improvement

The first experiment assesses the model’s performance on high-throughput open benchmarks. We conducted predictive evaluations using the testing data and procedures provided in the official ProteinGym repository (https://github.com/OATML-Markslab/ProteinGym). For each of the 217 assays, we used the sequence, structure (predicted by ColabFold 1.5; Mirdita et al. 2022), and homology sequences (retrieved by EVcouplings; Hopf et al. 2014) provided in the repository. For each DMS dataset, the model predicts the fitness scores of the mutants and calculates the weighted average Spearman’s ρ correlation between the predicted and ground truth scores. The standard deviation evaluates the stability of the model, which was computed using the bootstrap method defined in the official test script. We compared the overall performance of VenusREM with the top 18 models on the leaderboard. To avoid repetition, we retained only the highest scoring version for each method and reported their ranks in the full leaderboard in the first column of the table. The complete leaderboard is at https://proteingym.org/benchmarks.

As reported in Table 1 and Supplementary Table S4, our method demonstrates significant improvements over baseline methods in both overall and property-specific evaluations. Previous studies (Tan et al. 2023, Notin et al. 2024) found that structure-aware models (e.g. SaProt, ProtSSN, and ESM-if1) are considered to perform better in binding and stability predictions, while evolution-aware models (e.g. TranceptEVE, MSA Transformer) tend to achieve higher scores in activity prediction. In response, VenusREM integrates sequence, structure, and evolutionary information to deliver the best overall performance and consistently ranks at the top across different individual property types. A summary ranking of individual predictions among all baseline methods is shown in Fig. 2a, with individual scores detailed in Supplementary Figs S3–S7. In terms of the number of assays where the best rank is achieved, VenusREM outperforms all other baseline methods with the highest top-rank count (e.g. top 3, shown by the green bars) and the fewest lower rank count (e.g. ranks after 10, shown by the red bars). We also examined VenusREM’s performance with different homology sequence retrieval strategies (Fig. 2b). The validation scores were assessed on a subset of ProteinGym with 10% random samples from each of the 217 assays. Overall, incorporating either sequence or structural homologous sequences improves the model’s fitness prediction performance, and they are considerably insensitive to the choice of retrieval ratio [defined in (6)], with validation scores remaining stable between 0.51 and 0.54. The highest performance for all methods occurs at ratios of 0.8 and 0.6. Based on the ablation study results on the validation set (Supplementary Table S5), we set the default retrieval method for VenusREM to EVcouplings with a 0.8 retrieval ratio.

Table 1.

Spearman’s ρ correlation of mutation effect prediction (substitution) by zero-shot predictions on ProteinGym of different functions.

Rank Model seq str evo Avg. Spearman Activity Binding Expression Organismal Stability
VenusREM       0.518±0.000a 0.499a 0.454a 0.533a 0.455c 0.649b
1 ProSST ([Li et al. 2024)     0.507±0.000b 0.476 0.445b 0.530b 0.431 0.653a
5 PoET (Truong and Bepler 2023)     0.470±0.009c 0.494b 0.396c 0.466 0.475a 0.519
7 VespaG (Marquet et al. 2024)     0.458±0.008 0.493c 0.370 0.456 0.437 0.533
8 SaProt (Su et al. 2023)     0.457±0.009 0.458 0.378 0.488c 0.367 0.592
9 TranceptEVE (Notin et al. 2022a)     0.456±0.009 0.487 0.376 0.457 0.460b 0.500
10 GEMME (Laine et al. 2019)   0.455±0.012 0.482 0.383 0.438 0.452 0.519
13 ProtSSN (Tan et al. 2023)     0.449±0.008 0.466 0.366 0.449 0.396 0.568
16 EVE (Frazer et al. 2021)   0.439±0.012 0.464 0.386 0.408 0.447 0.491
22 VESPA (Marquet et al. 2022)   0.436±0.008 0.468 0.366 0.404 0.440 0.500
23 Tranception (Notin et al. 2022b)     0.434±0.009 0.465 0.349 0.450 0.436 0.471
26 MSA Trans (Roshan et al. 2021)     0.432±0.011 0.469 0.337 0.446 0.421 0.495
29 ESM-if1 (Hsu et al. 2022)   0.422±0.013 0.368 0.389 0.407 0.324 0.624c
31 DeepSequence (Riesselman et al. 2018)   0.419±0.013 0.455 0.363 0.390 0.413 0.476
34 ESM2 (Lin et al. 2023)   0.414±0.014 0.425 0.337 0.415 0.369 0.523
36 ESM-1v (Meier et al. 2021)   0.407±0.015 0.420 0.320 0.429 0.387 0.477
40 MIF-ST (Yang et al. 2023)     0.400±0.011 0.390 0.321 0.438 0.366 0.485
41 EVmutation (Hopf et al. 2017]   0.395±0.010 0.440 0.317 0.378 0.411 0.430
42 ESM-1b [Rives et al. 2021)   0.394±0.013 0.428 0.287 0.406 0.351 0.500
a

Score of the best-performing model.

b

Score of the second-best-performing model.

c

Score of the third-best-performing model.

Figure 2.

Figure 2.

A summary of baseline comparisons on the ProteinGym mutation effect prediction task. (a) Performance ranks across each assay. for instance, a Rank 1 for VenusREM with a value of 49 indicates that VenusREM achieves the highest performance on 49 out of 217 assays. (b) Performance of VenusREM’s ablation models with various homologous sequence search strategies and retrieval ratios, assessed on a 10% randomly split validation set.

3.2 VenusREM performs reliable prediction on favorable alkali resistance and binding affinity of VHH mutants

The second evaluation validates VenusREM’s effectiveness in fitness prediction for both single-site and multisite mutants. The engineering target is to enhance binding affinity and alkali resistance in the VHH antibody. This antibody type plays a crucial role in the development of clinical antibody-based therapeutics, serving as an affinity ligand to selectively purify biopharmaceuticals (Wang et al. 2014). In production, a clean-in-place process is typically required, which involves cleaning with an extremely alkaline solution for 24 h to eliminate impurities and contaminants. Therefore, improving the binding affinity and alkali resistance of the VHH antibody is a key requirement for industrial production. Here, we used experimental data from Kang et al. (2025) on 31 VHH antibody mutants with modifications at 1–4 sites. Their binding affinity and alkali resistance were assessed by EC50 values before and after treatment with 0.5 M NaOH for 24 h.

Figure 3a visualizes VenusREM’s fitness prediction scores with respect to experimental results (retrieved from Kang et al. (2025). Here, each point represents a mutant, and the gray pentagon denotes the wild-type template. Mutants are color-coded based on mutation depth. Overall, there is a significant correlation between the fitness prediction scores and experimental results. Note that higher EC50 values indicate poorer binding affinity and alkali resistance for VHH. Thus, a correlation closer to 1 represents better fitness prediction. In Fig. 3b, we also compare VenusREM with other popular sequence- and structure-based baseline methods with their top-performing versions from ProteinGym. Results indicate that most models fail to establish a negative correlation between fitness and the two experimental indicators. Although ESM2 and ESM1b achieve a negative correlation, the values remain close to zero, suggesting limited practical utility for these models in engineering the VHH antibody.

Figure 3.

Figure 3.

Performance analysis on low-throughput experimental datasets. (a) Scatter plot of predicted fitness scores (by VenusREM) versus experimentally obtained EC50 values. For both alkali resistance and binding affinity improvements, VenusREM’s scoring of 31 VHH antibody mutants by 1–4 sites shows a clear correlation with experimental data. (b) Performance of different models on the two assays of VHH antibody data. Only VenusREM successfully generated fitness scores that are moderately negatively correlated with EC50 values. (c) 3D structure of the template phi29 DNAP. The AA sites targeted for mutation across the 10 single-site mutants are highlighted and labeled with their wild-type residues. (d) Activity improvements in phi29 DNAP mutants. Among the 10 single-site mutants experimentally tested, 8 shows significant activity enhancements, with the top mutant exhibiting an eight-fold increase. (e) Thermostability of phi29 DNAP mutants. Three mutants demonstrate improvements in both thermostability and activity, with two of them showing significant gains.

3.3 VenusREM engineers phi29 DNAP toward significant activity enhancement with high positive rate

In the third experiment, we used VenusREM to enhance the catalytic activity of phi29 DNAP at higher temperatures. phi29 DNAP plays a key role in advancing isothermal amplification methods such as multiple displacement amplification and rolling-circle amplification (RCA) (Povilaitis et al. 2016). It facilitates efficient DNA amplification with low error rates, due to its remarkable strand-displacing activity with high fidelity and transcription processivity. While the existing phi29 DNAP exhibits high processivity and robust strand displacement activity at 30ºC, its activity and stability decline significantly at elevated temperatures. This limitation restricts its applications, particularly in cases requiring specific thermal conditions to optimize specificity or to denature complex secondary structures in DNA templates (Kamtekar et al. 2004, de Vega et al. 2010, Manrao et al. 2012).

Therefore, we employed VenusREM to enhance the activity of phi29 DNAP at a higher temperature (i.e. 42ºC). We selected the C3 mutant as the template for further improvement, which is a phi29 DNAP mutant obtained through earlier directed evolution with high thermostability. However, it exhibits low ssDNA yield during in vitro amplification at 42ºC (Fig. 3d) and requires further enhancement (Povilaitis et al. 2016). We designed 10 single-site mutations from C3 and evaluated their RCA activity at 42ºC using an ssDNA template (Fig. 3c). The average results from three independent repetitions show that eight of these mutants exhibit a significant activity enhancement over C3 with an over three-fold increase (Fig. 3d). The top-performing mutant, phi29 DNAPY449G, achieved a 6.5-fold increase in activity. Additionally, we assessed the thermostability of the mutants using DSF, observing a clear increase in Tm values in three of the eight active positive mutants (Fig. 3e). Notably, in directed evolution, there is generally a tradeoff between activity and stability. However, the phi29 DNAP mutants obtained by VenusREM, such as phi29 DNAPL567E and phi29 DNAPS551L, demonstrate simultaneous improvements in both assays, presenting a new possibility for designing high-performance variants.

4 Discussion and conclusion

Protein engineering is a central topic in synthetic biology, where novel mutants are typically identified through rational design, machine learning, or pretrained deep neural networks. Recent advances in pretrained deep learning methods have shown remarkable success in discovering favorable mutations. These protein embedding algorithms often benefit from incorporating multiple protein modalities to generate more expressive vector representations. For instance, as highlighted by Notin et al. (2024) and Tan et al. (2023), structure-aware models are generally more effective at enhancing protein stability and binding, whereas sequence-centric models excel at improving enzymatic activity. However, the potential insights offered by evolutionary information remain underexplored. Conserved regions in proteins, for example, are often poor candidates for mutations, and AA conservations are typically derived from evolutionary analyses of homologous sequence data. Furthermore, while structural models often rely on predicted 3D structures in the absence of crystallographic data, these predictions may contain inaccuracies. Homologous sequences can mitigate this issue by providing explicit coevolutionary relationships between residue pairs (Supplementary Figs S1 and S2). Unlike existing approaches, we propose a simple yet flexible method for seamlessly integrating evolutionary information from homologous sequences into pretrained models.

On the evaluation side, the current framework heavily relies on high-throughput datasets such as ProteinGym, which facilitate statistically significant comparisons of zero-shot models without incurring experimental costs. However, high-throughput experiments often suffer from inaccuracies and are heavily biased toward negative mutants, raising concerns about the practical utility of top-performing models. To address this limitation, we extract low-throughput experimental data and establish a multidimensional post hoc analysis scheme. This approach provides a validation mechanism similar to wet-lab experiments but without the need for new experimental data. It allows researchers without access to biological experimental facilities to independently assess their models and enables direct comparisons between different deep learning approaches. In this study, we further demonstrate the practical utility of our method by selecting an important enzyme with specific modification requirements, performing single-site mutations, and experimentally validating the results. Our experimental and analytical findings indicate that the proposed model significantly outperforms existing methods on large-scale datasets, exhibits greater reliability on small-scale experimental data, and identifies novel mutants with improved activity and stability in real-world applications.

Supplementary Material

btaf189_Supplementary_Data

Contributor Information

Yang Tan, Institute of Natural Sciences, Shanghai Jiao Tong University, Shanghai, 200240, China; School of Information and Science, East China University of Science and Technology, Shanghai, 200231, China; Shanghai Artificial Intelligence Laboratory, Shanghai, 200232, China; Zhangjiang Institute for Advanced Study, Shanghai Jiao Tong University, Shanghai, 201203, China.

Ruilin Wang, School of Information and Science, East China University of Science and Technology, Shanghai, 200231, China.

Banghao Wu, Institute of Natural Sciences, Shanghai Jiao Tong University, Shanghai, 200240, China; Zhangjiang Institute for Advanced Study, Shanghai Jiao Tong University, Shanghai, 201203, China.

Liang Hong, Institute of Natural Sciences, Shanghai Jiao Tong University, Shanghai, 200240, China; Shanghai Artificial Intelligence Laboratory, Shanghai, 200232, China; Zhangjiang Institute for Advanced Study, Shanghai Jiao Tong University, Shanghai, 201203, China.

Bingxin Zhou, Institute of Natural Sciences, Shanghai Jiao Tong University, Shanghai, 200240, China; Zhangjiang Institute for Advanced Study, Shanghai Jiao Tong University, Shanghai, 201203, China.

Author contributions

Yang Tan (Conceptualization, Data curation, Software, Methodology, Formal analysis, Validation, Investigation, and Writing—review & editing), Ruilin Wang (Conceptualization, Data curation, and Investigation), Banghao Wu (Conceptualization, Data curation, Validation, Investigation, and Writing—original draft), Liang Hong (Funding acquisition and Supervision), Bingxin Zhou (Formal analysis, Funding acquisition, Investigation, Project administration, Supervision, Visualization, Writing—original draft, and Writing—review & editing)

Supplementary data

Supplementary data are available at Bioinformatics online.

Conflict of interest: The authors have no competing interests to declare that are relevant to the content of this article.

Funding

This work was supported by grants from the National Natural Science Foundation of China (grant numbers 62302291, 12104295), the Computational Biology Key Program of Shanghai Science and Technology Commission (23JS1400600), Shanghai Jiao Tong University Scientific and Technological Innovation Funds (21X010200843), Science and Technology Innovation Key R&D Program of Chongqing (CSTB2022TIAD-STX0017), and the Student Innovation Center at Shanghai Jiao Tong University, and Shanghai Artificial Intelligence Laboratory.

Data availability

The data underlying this article are available in GitHub repository named VenusREM, at https://github.com/ai4protein/VenusREM.

References

  1. Abramson J, Adler J, Dunger J  et al.  Accurate structure prediction of biomolecular interactions with AlphaFold 3. Nature  2024;630:493–500. [DOI] [PMC free article] [PubMed] [Google Scholar]
  2. de Vega M, Lázaro JM, Mencía M  et al.  Improvement of φ29 DNA polymerase amplification performance by fusion of DNA binding motifs. Proc Natl Acad Sci  2010;107:16506–11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  3. Eddy SR.  Accelerated profile HMM searches. PLoS Comput Biol  2011;7:e1002195. [DOI] [PMC free article] [PubMed] [Google Scholar]
  4. Frazer J, Notin P, Dias M  et al.  Disease variant prediction with deep generative models of evolutionary data. Nature  2021;599:91–5. [DOI] [PubMed] [Google Scholar]
  5. He P, Liu X, Gao J  et al. DeBERTa: decoding-enhanced BERT with disentangled attention. In: The International Conference on Learning Representations. Virtual, 2020.
  6. Hopf TA, Schärfe CPI, Rodrigues JPGLM, Green AG.  Sequence co-evolution gives 3D contacts and structures of protein complexes. eLife  2014;3:e03430. [DOI] [PMC free article] [PubMed] [Google Scholar]
  7. Hopf TA, Ingraham JB, Poelwijk FJ  et al.  Mutation effects predicted from sequence co-variation. Nat Biotechnol  2017;35:128–35. [DOI] [PMC free article] [PubMed] [Google Scholar]
  8. Hsu C, Verkuil R, Liu J  et al. Learning inverse folding from millions of predicted structures. In: International Conference on Machine Learning, p.8946–70. Baltimore, USA: PMLR, 2022.
  9. Jing B, Eismann S, Suriana P  et al. Learning from protein structure with geometric vector perceptrons. In: International Conference on Learning Representations. Virtual,  2021.
  10. Kamtekar S, Berman AJ, Wang J  et al.  Insights into strand displacement and processivity from the crystal structure of the protein-primed DNA polymerase of bacteriophage φ29. Mol Cell  2004;16:609–18. [DOI] [PubMed] [Google Scholar]
  11. Yang Kevin K, Zanichelli Niccolò, Yeh Hugh. Masked inverse folding with sequence transfer for protein representation learning. Protein Eng Des Sel  2023;36:gzad015. [DOI] [PubMed] [Google Scholar]
  12. Laine E, Karami Y, Carbone A.  GEMME: a simple and fast global epistatic model predicting mutational effects. Mol Biol Evol  2019;36:2604–19. [DOI] [PMC free article] [PubMed] [Google Scholar]
  13. Li M, Tan Y, Ma X  et al. ProSST: protein language modeling with quantized structure and disentangled attention. In: The Thirty-eighth Annual Conference on Neural Information Processing Systems. Vancouver, Canada, 2024.
  14. Lin Z, Akin H, Rao R  et al.  Evolutionary-scale prediction of atomic-level protein structure with a language model. Science  2023;379:1123–30. [DOI] [PubMed] [Google Scholar]
  15. Kang L, Wu B, Zhou B  et al.  AI-enabled alkaline-resistant evolution of protein to apply in mass production. eLife  2025;13:RP102788. [DOI] [PMC free article] [PubMed] [Google Scholar]
  16. Lu H, Diaz DJ, Czarnecki NJ  et al.  Machine learning-aided engineering of hydrolases for PET depolymerization. Nature  2022;604:662–7. [DOI] [PubMed] [Google Scholar]
  17. Madani A, Krause B, Greene ER  et al.  Large language models generate functional protein sequences across diverse families. Nat Biotechnol  2023;41:1099–106. [DOI] [PMC free article] [PubMed] [Google Scholar]
  18. Manrao EA, Derrington IM, Laszlo AH  et al.  Reading DNA at single-nucleotide resolution with a mutant MspA nanopore and phi29 DNA polymerase. Nat Biotechnol  2012;30:349–53. [DOI] [PMC free article] [PubMed] [Google Scholar]
  19. Marquet C, Heinzinger M, Olenyi T  et al.  Embeddings from protein language models predict conservation and variant effects. Hum Genet  2022;141:1629–47. [DOI] [PMC free article] [PubMed] [Google Scholar]
  20. Marquet C, Schlensok J, Abakarova M  et al.  Expert-guided protein language models enable accurate and blazingly fast fitness prediction. Bioinformatics  2024;40:btae621. [DOI] [PMC free article] [PubMed] [Google Scholar]
  21. Meier J, Rao R, Verkuil R  et al.  Language models enable zero-shot prediction of the effects of mutations on protein function. Adv Neural Inform Process Syst  2021;34:29287–303. [Google Scholar]
  22. Mirdita M, Schütze K, Moriwaki Y  et al.  Colabfold: making protein folding accessible to all. Nat Methods  2022;19:679–82. [DOI] [PMC free article] [PubMed] [Google Scholar]
  23. Notin P, Van Niekerk L, Kollasch AW  et al. TranceptEVE: combining family-specific and family-agnostic models of protein sequences for improved fitness prediction. In: NeurIPS 2022 Workshop on Learning Meaningful Representations of Life.  New Orleans, USA, 2022a.
  24. Notin P, Dias M, Frazer J  et al. Tranception: protein fitness prediction with autoregressive transformers and inference-time retrieval. In: International Conference on Machine Learning, p.16990–17017. Baltimore, USA: PMLR, 2022b.
  25. Notin P, Kollasch A, Ritter D  et al.  ProteinGym: large-scale benchmarks for protein fitness prediction and design. In: The Thirty-eighth Annual Conference on Neural Information Processing Systems. Vancouver, Canada, 2024. [Google Scholar]
  26. Orengo CA, Michie AD, Jones S  et al.  CATH—a hierarchic classification of protein domain structures. Structure  1997;5:1093–109. [DOI] [PubMed] [Google Scholar]
  27. Povilaitis T, Alzbutas G, Sukackaite R  et al.  In vitro evolution of phi29 DNA polymerase using isothermal compartmentalized self-replication technique. Protein Eng Des Sel  2016;29:617–28. [DOI] [PubMed] [Google Scholar]
  28. Riesselman AJ, Ingraham JB, Marks DS.  Deep generative models of genetic variation capture the effects of mutations. Nat Methods  2018;15:816–22. [DOI] [PMC free article] [PubMed] [Google Scholar]
  29. Rives A, Meier J, Sercu T  et al.  Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences. Proc Natl Acad Sci  2021;118:e2016239118. [DOI] [PMC free article] [PubMed] [Google Scholar]
  30. Roshan M, Rao J, Liu R  et al. MSA transformer. In: International Conference on Machine Learning, p.8844–56. PMLR, Virtual, 2021.
  31. Su J, Han C, Zhou Y  et al. SaProt: protein language modeling with structure-aware vocabulary. In: The Twelfth International Conference on Learning Representations. Kigali, Rwanda, 2023.
  32. Tan Y, Zhou B, Lirong Z  et al. Semantical and topological protein encoding toward enhanced bioactivity and thermostability. eLife 2024:RP98033. [DOI] [PMC free article] [PubMed]
  33. Tan Y, Zheng J, Hong L  et al. ProtSolM: protein solubility prediction with multi-modal features. In: 2024 IEEE International Conference on Bioinformatics and Biomedicine (BIBM), p.223–232. Lisbon, Portugal: IEEE, 2024a.
  34. Tan Y, Zheng L, Zhong B  et al. Protein representation learning with sequence information embedding: does it always lead to a better performance? In: 2024 IEEE International Conference on Bioinformatics and Biomedicine (BIBM), p.233–9. Lisbon, Portugal: IEEE, 2024b.
  35. Truong T Jr, Bepler T.  PoET: a generative model of protein families as sequences-of-sequences. Adv Neural Inform Process Syst  2023;36:77379–415. [Google Scholar]
  36. Van Kempen M, Kim SS, Tumescheit C  et al.  Fast and accurate protein structure search with Foldseek. Nat Biotechnol  2024;42:243–6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  37. Wang J, Bever CRS, Majkova Z  et al.  Heterologous antigen selection of camelid heavy chain single domain antibodies against tetrabromobisphenol a. Anal Chem  2014;86:8296–302. [DOI] [PMC free article] [PubMed] [Google Scholar]
  38. Zhou B, Tan Y, Hu Y  et al.  Protein engineering in the deep learning era. mLife  2024a;3:477–91. [DOI] [PMC free article] [PubMed] [Google Scholar]
  39. Zhou B, Zheng L, Wu B  et al.  A conditional protein diffusion model generates artificial programmable endonuclease sequences with enhanced activity. Cell Discov  2024b;10:95. [DOI] [PMC free article] [PubMed] [Google Scholar]
  40. Zhou B, Zheng L, Wu B  et al.  Protein engineering with lightweight graph denoising neural networks. J Chem Inf Model  2024c;64:3650–61. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

btaf189_Supplementary_Data

Data Availability Statement

The data underlying this article are available in GitHub repository named VenusREM, at https://github.com/ai4protein/VenusREM.


Articles from Bioinformatics are provided here courtesy of Oxford University Press

RESOURCES