Table 1. Identification of the 43 kDa band as Nogo-B.
The mass of tryptic peptides were scanned against the Swiss-Prot, Genpep and NCBInr databases as previously described [15].
| Masses | Residue no. | ||||
|---|---|---|---|---|---|
| Source of purified protein | Submitted | Matched | Start | End | Peptide sequence |
| Murine RAW cells | 802.3858 | 802.3848 | 105 | 110 | QPSWER |
| 944.4238 | 944.4226 | 235 | 242 | SDEGHPFR | |
| 1450.7661 | 1450.7694 | 168 | 180 | GSGSVVVDLLYWR | |
| 1490.7506 | 1490.7603 | 259 | 272 | YSNSALGHVNSTIK | |
| Human HeLa cells | 944.4354 | 944.4226 | 248 | 255 | SDEGHPFR |
| 1271.7121 | 1271.7112 | 92 | 104 | GPLPAAPPVAPER | |
| 1537.7695 | 1537.8015 | 180 | 193 | GSSGSVVVDLLYWR | |
| 1607.8362 | 1607.8264 | 339 | 352 | HQAQIDHYLGLANK | |
| 1807.9317 | 1807.9329 | 256 | 271 | AYLESEVAISEELVQK | |
| 3271.6215 | 3271.6938 | 57 | 91 | KPAAGLSAAPVPTAPAAGAPLMDFGNDFFVPPAPR | |