TABLE 2.
Sequence comparison of different S3–S4 linkers of voltage-dependent ion channels
| Channel | Literature | S3 end | Linker | S4 start | Linker length | dF/F |
|---|---|---|---|---|---|---|
| Shaker | Cha and Bezanilla (1998) | T329 | VVAEEEDTLNLPKAPVSPQDKSSNQAMSLA | I360 | 30 | 25% |
| Shaker Δ330–355 | Sørensen et al. (2000) | T329 | AMSLA | I360 | 5 | 1–2% |
| EAG1 | Schonherr et al. (2002) | F312 | ENVDEGISSLFSS | A325 | 13 | 13% |
| HERG | Smith and Yellen (2002) | F515 | GSGSEELIG | L525 | 9 | 3% |
| hSLO | R. Olcese (personal comm.) | L199 | NRSWL | G205 | 5 | <1% |
| NaChBac | T110 | V111 | 0 | <1%* | ||
| KvAP | G112 | LG | L115 | 2 | — |
See Fig. 8. The start of S4 was set independent of the literature to two amino acids before the first charge, R or K, in S4. Anionic amino acids are printed in bold, and the attachment sites of the probes are underlined. dF/F shows the maximal relative fluorescence change measured at that site according to literature.
*
Indicates that these measurements were obtained from cells, in contrast to the rest, which were obtained from oocytes.