Table 1.

Summary of MALDI-TOF MS and amino acid sequence data for SLR1-BP1 and SLR1-BP2

	SLR1-BP1	SLR-BP2
Protein mass* (M + H)+	6317.6 (6317.1)	6301.9 (6301.1)
N-terminal sequence	(Q†)KGGP‡VRKQCVEQYPDPNGKCVIDQCKAQCA	(Q†)KGGPVRKQCVEQYPDPNGKCVIDQCKAQCA
Internal fragments§	Peak 1 (28.8 min)  GHMQCRCDYHC	Peak 1 (28.8 min)  GHMQCRCDYHC
	Peak 2 (29.4 min)  CVIDQCK	Peak 2 (29.4 min)  CVIDQCK
	Peak 3 (30.3 min)  QCVEQYPDPNGK	Peak 3 (30.3 min)  QCVEQYPDPNGK
	Peak 4 (32.4 min)  GGLARCIDTGK	Peak 4 (32.4 min)  GGLARCIDTGK

^*Experimental masses obtained by MALDI-TOF MS. Values in parentheses are the relative masses calculated from the deduced amino acid sequences shown in Fig. 3 and based on all eight cysteines forming intramolecular disulfide bridges. 

^†N-terminal sequences were obtained after pyroglutamate aminopeptidase treatment. 

^‡The phenylthiohydantoin derivative of hydroxyproline was detected. 

^§ Lysyl endopeptidase fragments were separated by reverse-phase HPLC and sequenced (see Materials and Methods). Values in parentheses indicate the retention time of each fragment.