TABLE 1.
Peptide | Sequence | Charge | ΔG (kcal mol−1) |
---|---|---|---|
Defr1 | DPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK | +6 (+12) | −1.92 (−3.84) |
Defr1 Y5C | DPVTCIRNGGICQYRCIGLRHKIGTCGSPFKCCK | +6 (+12) | −3.13 (−6.26) |
Defr1-1cys | DPVTYIRNGGIAQYRAIGLRHKIGTAGSPFKCAK | +6 (+12) | −3.56 (−7.12) |
Amino acid sequence, charge, and hydrophobicity (ΔG) values as calculated by Wimley and White (16) are given for Defr1, Defr1Y5C, and Defr1-1cys. Values are for the monomeric forms of the peptides, with values for the dimeric forms in brackets. Boldface letters indicate the position of cysteine residues in a canonical six cysteine β-defensin motif.