Table 2.
Fragment masses that matched 15a2 peptides | ||||
---|---|---|---|---|
Observed mass | Deduced mass | Start | End | Sequences a |
1435.37 | 1435.64 | 20 | 32 | DYPAPPPPPPKPY |
2501.07 | 2500.84 | 20 | 42 | DYPAPPPPPPKPYHAPPPPPYHA |
1157.30 | 1157.38 | 22 | 32 | PAPPPPPPKPY |
2763.20 | 2762.17 | 22 | 47 | PAPPPPPPKPYHAPPPPPYH APPHHA |
1846.26 | 1846.16 | 24 | 40 | PPPPPPKPYHAPPPPPY |
1180.28 | 1180.33 | 33 | 43 | HAPPPPPYHAP |
1388.28 | 1388.55 | 37 | 49 | PPPYHAPPHHAPA |
1246.49 | 1246.45 | 58 | 69 | YPVKAPAAKCGA |
846.20 | 846.01 | 65 | 72 | AKCGANLL |
702.68 | 702.82 | 73 | 79 | VGCAPSV |
892.21 | 892.08 | 80 | 87 | AHVPCVPV |
1708.22 | 1709.00 | 80 | 95 | AHVPCVPVHPHPPPPA |
1937.26 | 1938.24 | 81 | 97 | HVPCVPVHPHPPPPAHY |
1345.21 | 1345.53 | 86 | 97 | PVHPHPPPPAHY |
| ||||
1 | MNKIIAALVLFTAVIGALADYPAPPPPPPKPYHAPPPPPYHAPPHHAPAP | 50 | ||
51 | LHPVVHTYPVKAPAAKCGANLLVGCAPSVAHVPCVPVHPHPPPPAHY | 97 |
The artificial modifications of amino acid residues, i.e. carboxyamidomethyl cysteine, propionamide cysteine, or methionine sulfoxide, are not shown. The sequence at the bottom of the Table is 15a2 with the identified peptides underlined.