Figure - PMC

Skip to main content

An official website of the United States government

Here's how you know

Here's how you know

Official websites use .gov
A .gov website belongs to an official government organization in the United States.

Secure .gov websites use HTTPS
A lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.

View full-text article in PMC

. 2006 Sep;15(9):2107–2119. doi: 10.1110/ps.062237606

Search in PMC
Search in PubMed
View in NLM Catalog
Add to search

Copyright © 2006 The Protein Society

PMC Copyright notice

Figure 8. — Identification of Glu-2 as the site of photoincorporation of 3-azioctanol by LC/MS/MS using LTQ mass spectrometer. MS/MS data for the 3-azioctanol (5 mM) modified 31-residue peptide ASVGSHEFIATFFGQPTFCSVCKEFVWGLNK obtained from the tryptic digest of PKCδ C1A. The site of attachment for 3-azioctanol was deduced from this spectrum. At the top of the figure, the predicted mass/charge ratio of N-terminal ions (b-ions) and C-terminal ions (y-ions) is shown above and below the sequence, respectively. The horizontal arrows show which m/z values for the b-ions (above) and y-ions (below) have a mass of 128 Da added to them. Observed values are shown in bold. No ions were observed below a m/z of 400.