Table 3.

Comparison of conorfamide-Sr2 with some FaRPs from mouse (A) and mollusks (B)

	Sequence	Organism or Mouse peptide^a	Reference
	GPMγDPLγIIRI^*	*Conus spurius*	This work
(A)
	SVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRF^*	RFRP-1	[24]
	VNMEAGTRSHFPSLPQRF^*	RFRP-3	[24]
(B)
	FMRF^*	*Macrocallista nimbosa*	[46]
	FLRF^*	*Pomacea paludosa*	[45]
	GDPFLRF^*	*Siphonaria pectinata*	[48]
	EFLRI^*	*Lymnaea stagnalis*	[55]
	ZNYLAFPRM^*		[44]
	ZFLRI^*		[55]
	SGYLAFPRM^*		[44]
	QFYRI^*		[55]
	ZFYRI^*		[55]
	ALSGDAFLRF^*		[33]
	(G/S)DPFLRF^*		[15]
	(Z/Q/G)GSLFRF^*		[25]
	(G/N)TLLRF^*		[25]
	HDYMRF^*		[54]
	TLFRF^*		[25]
	FMRF^*		[15]
	LSSFVRI^*	*Fusinus ferrugineus*	[29]
	(G/S)SLFRF^*		[29]
	MNYLAFPRM^*	*Helix aspersa*	[49]
	SGYLAFPRM^*		[49]
	(S/N)DPFLRF^*		[49]
	ZDPFLRF^*		[47]
	ZFYRF^*		[50]
	FMRF^*		[49]
	FLRF^*		[49]
	PMSMLRL^*	*Aplysia californica*	[12]
	MNYLAFPRM^*		[49]
	ARPGYLAFPRM^*		[12]
	GGALFRF^*		[13]
	STLFRF^*		[13]
	GSLFRF^*		[22]
	FMRF^*		[56]
	MNYLAFPRM^*	*Aplysia brasiliana*	[37]
	FMRF^*		[30]
	GDPFLRF^*	*Helisoma trivolvis*	[34]
	FMRF^*		[34]
	FLRF^*		[34]

Names have been taken from the original references. The one-letter code is employed for standard amino acids. For post-translational modifications: γ, gamma-carboxyglutamate; Z, pyroglutamic acid;

, amidated C-terminus. Bold-faced, double-underlined residues indicate identity with conorfamide-Sr2; bold-faced, underlined residues indicate conservative substitutions with conorfamide-Sr2. Some peptides differing only at the N-terminus have been grouped in the same line, indicating the distinct N-termini separated by slashes and between parentheses.