Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Backbone atoms (N, C, and Cα) for the 25 low-energy structures (with the backbone aligned between residues 25 and 45) of the M13 major coat protein in SDS micelles. Structures were obtained from the Brookhaven protein data bank (entry code 2CPS) as published by Papavoine et al. (1998). Thin lines indicate U-shaped configurations that are incompatible with a planar membrane environment. The complete amino acid sequence is AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIV GATIGIKLFKKFTSKAS.
