Table I.
Posttranslationally modified peptides observed
Listed are protein identification number (ID), precursor m/z and z observed, error, sequence identified, and E value for the peptide. Phosphorylated residues are labeled in the peptide sequence with a "P" in superscript to their right side.
| Protein ID | m/z | z | Error | Peptide sequence | Expectation (E value) |
|---|---|---|---|---|---|
| ppm | |||||
| At1g75080 | 863.7203 | 3 | 31 | QSMASFNYPFYAVSPAPASPPTHR | 7.0e−7 |
| At1g12270 | 569.9506 | 3 | 18 | ANRGDLTPPEELKER | 3.3e−4 |
| At1g62740 | 569.9493 | 3 | 16 | ANRGDLTPPEELKER | 7.4e−5 |
| At4g37870 | 930.4570 | 3 | 33 | KRSPAPTTPPINQNAAAAFAAVSEEER | 4.1e−11 |
| At4g37870 | 667.9269 | 5 | 22 | KTDGSTTPPAYAHGQHHSIFSPATGAVSDSSLK | 1.6e−5 |