Skip to main content
. Author manuscript; available in PMC: 2009 Jun 1.
Published in final edited form as: Protein Expr Purif. 2008 Mar 7;59(2):249–257. doi: 10.1016/j.pep.2008.02.005

Figure 3.

Figure 3

MALDI-TOF-MS (Voyager, ABI) spectrometry analysis of HPLC purified CB2271-326.

CB2271-326 sequence:

GTTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGS (the N-terminal Gly residue is from the TEV protease recognition site).