Table 1.

Amino acid encoding.

Amino acid	Property	Dayhoff
C	sulfur polymerization	a
G, S, T, A, P	small	b
D, E, N, Q	acid and amide	c
R, H, K,	basic	d
L, V, M, I	hydrofobic	e
Y, F, W	aromaticity	f

The Dayhoff encoding takes into account the properties of each residue: sulfur polymerization, small, acid and amide, basic, hydrophobic and aromaticity. For example, for the input protein segment SVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRV the output encoded sequence would be: beeeccbeebeefcbfcbdedbbcbebcdebede