Skip to main content
. 2008 Sep 10;15(11):1674–1683. doi: 10.1128/CVI.00164-08

TABLE 2.

Mouse anti-FALVAC-1A peptide titers found in ELISAsa

Epitope originb Peptide Immune reactivityc Anti-FALVAC-1A peptide titer of pooled sera (10 mice)d
C57BL/6
B10.BR
B10.D2
ICR
CRL-1005 ISA-720 QS-21 AlPO4 No adj. CRL-1005 ISA-720 QS-21 AlPO4 No adj. CRL-1005 ISA-720 QS-21 AlPO4 No adj. CRL-1005 ISA-720 QS-21 AlPO4 No adj.
CSP p865 B 6,400 3,200 3,200 800 100 51,200 6,400 12,800 3,200 200 6,400 6,400 6,400 200 100 25,600 12,800 12,800 3,200 1,600
CSP p843 Th/Tc 800 400 - - 100 25,600 25,600 51,200 1,600 1,600 12,800 25,600 6,400 - - 102,400 25,600 51,200 12,800 1,600
CSP p867 Th - - - - - - - - - - - - - - - - - - - -
MSP-1 p844 B 3,200 6,400 3,200 3,200 100 51,200 3,200 25,600 6,400 1,600 12,800 12,800 6,400 100 100 6,400 12,800 6,400 100 100
MSP-1 p845 B 800 400 800 400 100 - 12,800 200 1,600 400 6,400 6,400 3,200 1,600 400 51,200 25,600 25,600 6,400 1,600
LSA-1 p846 Tc - - - - 6,400 1,600 100 - 400 800 800 - - 100 - 100 - 800 100
CSP p847 B - - - - - - 200 - - - - 400 - - 100 800 - - - 100
AMA-1 p848 B 6,400 1,600 6,400 1,600 100 6,400 800 25,600 - - 1,600 800 1,600 800 100 12,800 12,800 6,400 800 100
AMA-1 p849 B 3,200 3,200 12,800 3,200 100 6,400 6,400 25,600 6,400 - 1,600 6,400 6,400 - - 12,800 12,800 12,800 6,400 1,600
RAP-1 p866 B 12,800 6,400 12,800 6,400 800 25,600 6,400 51,200 25,600 1,600 25,600 25,600 51,200 6,400 - 102,400 25,600 12,800 25,600 1,600
LSA-1 p851 Tc - - - - - - - - - - - - - - - - - - - -
EBA-175 p863 B - - - - - - - - - - - - - - - - - - - -
MSP-2 p853 B - - - - - - - - - - - - - - - - - - - -
MSP-2 p854 B 100 - - - 100 - - - - - - - - - - 100 - - - -
EBA-175 p862 B - - - - - - - - - - - - - - - 6,400 400 3,200 - 100
AMA-1 p856 Tp - - - - - - - - - - - - - - - 1,600 1,600 - 1,600 100
AMA-1 p857 Tp 1,600 1,600 12,800 1,600 100 25,600 3,200 3,200 3,200 1,600 6,400 6,400 3,200 400 100 51,200 12,800 12,800 25,600 1,600
EBA-175 p864 B - - - - - - - - - - - - - - - - - - - -
RAP-1 p859 Tp 400 - - - 100 - - 100 - - - - - - - 12,800 800 1,600 100 100
RAP-1 p860 Tp - - - - - - - - - - - - - - - 100 200 - - -
MSP-1 p861 Tp - - - - - - - - - - - - - - - 100 100 100 - -
a

Four strains of mice were immunized on days 0, 14, and 28 with 10 μg FALVAC-1A formulated with the indicated adjuvants. Sera collected on day 42 (serum with peak antibody titer) were used for peptide ELISA. ELISA titers against each epitopic peptide were determined by titration. The order of epitopes is the same as in Table 1. In CSP, the first epitope, Th/Tc, KPKDELDYENDIEKKICKMEKCS runs continuously into the second Th epitope, SVFNVVNS. Antibody responses were determined jointly against the peptide KPKDELDYENDIEKKICKMEKCSSVFNVVNS.

b

The origin of the epitope is shown as follows: CSP, circumsporozoite protein; MSP-1, merozoite surface protein-1; LSA-1, liver stage antigen-1; AMA-1, apical membrane antigen-1; RAP-1, rhoptry-associated protein-1; EBA-175, erythrocyte binding antigen-175; MSP-2, merozoite surface protein-2.

c

The immune reactivity of each epitope (synthetic peptide) is shown as follows: B, B cell; Th/Tc, T helper and cytotoxic T cell; Th, T helper cell; Tc, cytotoxic T cell; Tp, T proliferative cell.

d

Four strains of mice (C57BL/6, B10.BR, B10.D2, and ICR) were immunized with 10 μg FALVAC-1A formulated with adjuvants (copolymer CRL-1005, Montanide ISA-720, QS-21, and AlPO4) or with no adjuvant (No adj.). Dashes indicated that the titer was <100.