Skip to main content
. Author manuscript; available in PMC: 2010 Mar 1.
Published in final edited form as: J Neuroimmune Pharmacol. 2008 Nov 26;4(1):116–128. doi: 10.1007/s11481-008-9140-4

Figure 5. Mass spectrometric identification of a fragment derived by caplain from OTK18 peptide.

Figure 5

A, Mass spectrum of OTK peptide (GKVFI-PHTRKKPYKCHDCGKAFFQMLSLLLYECS) analyzed by MALDI 4800 TOF. B, A predominant 1054.59 m/z ion (MALDI-TOF) was detected after digestion of OTK18 peptide with calpain. C, MS/MS (MALDI-TOF/TOF) spectra of generated by collision induced dissociation of a precursor ion 1054.59 m/z showing corresponding y- and b- ions. D, Amino acid sequence derived from MS/MS spectra of precursor ion 1054.59 m/z.