Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Predicted protein motifs of the N extended AChE. The N-extended AChE tail forecasts interaction with cell signaling proteins involved in different cellular pathways (eukaryotic linear motif) http://elm.eu.org. Peptide sequence: MSCPDRTLVTKVRSHPSGNQHRPTRGGSRSFHCRRGVRPRPAALRVLPRCPAFSDAA
