Skip to main content
. 2009 Nov 30;4(11):e8084. doi: 10.1371/journal.pone.0008084

Table 1. The predicted transmembrane (TM), intracellular loop (IL) and extracellular loop (EL) regions of the human CCR4 protein.

N terminus mnptdiadttldesiysnyylyesipkpctkegi
TM1 kafgelflpplyslvfvfgllgnsvvvlvlfky
IL1 Klrs
TM2 mtdvyllnlaisdllfvfslpfwgyyaadq
EL2 Wfg
TM3 lglckmiswmylvgfysgiffvmlmsidrylaiv
IL2 havfslrart
TM4 ltygvitslatwsvavfaslpgfl
EL2 fstcyternhtycktkyslnsttw
TM5 kvlssleinilglviplgimlfcysmiirt
IL3 lqhcknekknk
TM6 avkmifavvvlflgfwtpynivlfletlve
IL3 levlqdctferyldyaiq
TM7 atetlafvhcclnpiiyfflgekfr
C terminus kyilqlfktcrglfvlcqycgllqiysadtpsssytqstmdhdlhdal