| Primary antibody |
Cells identified |
Immunogen |
Species |
Catalogue number/company |
Reference |
| GFAP |
Astrocytes(1:500) |
GFAP from bovine spinal cord |
Rabbit poly-IgG |
ZO334/Dako |
Single 50 kDa band on immunoblot (Jakovcevski et al., 2007) |
| GFAP |
Astrocytes(1:250) |
GFAP from porcine spinal cord |
Mouse mono-IgG |
MAB3402/Chemicon |
Single 51 kDa band on immunoblot (Debus et al., 1983) |
| Desmin |
Pericytes(1:50) |
Desmin protein isolated from chicken gizzard |
Rabbit poly-IgG |
AB907/Chemicon |
Single 53 kDa band on immunoblot (Corti et al., 2005) |
| Iba1 |
Microglia/ macrophages(1:250) |
Synthetic peptide fragment corresponding to amino acids 118–131 within the C-terminus of Iba1 (LRMILMYEEKNKEH-C) |
Rabbit poly-IgG |
# 019-19741; lot HNM3505/Wako |
Single 17 kDa band on immunoblot (Jakovcevski et al., 2007) |
| Map2 |
Neurons(1:200) |
Map2 from bovine brain |
Mouse mono-IgG |
M1406/Sigma |
Single 280 kDa band on immunoblot (Binder et al., 1986) |
| Aqp4 |
Perivascular astrocytic endfeet(1:100) |
Synthetic peptide fragment corresponding to amino acids 244–323 within the C-terminus of human Aqp4 (AGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV-C) |
Rabbit poly-IgG |
Aqp4 (H-80); sc-20812/Santa Cruz Biotechnology |
Single 32 kDa band on immunoblot (Quick and Cipolla, 2005) |
| PAI-1 |
Perivascular astrocytic endfeet(1:100) |
Secretion product of a dexamethasone-stimulated HTC rat hepatoma cell line |
Rabbit poly-IgG |
#1062/American Diagnostica |
Single 50 kDa band on immunoblot (Allaire et al., 1998) |
| IGFBP-3 |
Perivascular astrocytic endfeet(1:50) |
Synthetic peptide corresponding to amino acids 241–291 within the C-terminus of mouse IGFBP-3 (DKKGFYKKKRCRPSKGRKQSFCWCVDKYGQRLPGYDTKGKDDVHCLSV QSQ-C) |
Goat poly-IgG |
M-19; sc-6004/Santa Cruz Biotechnology |
Single 42 kDa band on immunoblot (Ye et al., 2003) |
| IL-6 |
Perivascular astrocytic endfeet(1:50) |
Recombinant rat IL-6 (rrIL-6) derived from Escherichia coli
|
Goat poly-IgG |
AF506; lot # BCZ04/R&D Systems |
Single 27 kDa band on immunoblot (Wang et al., 2004) |
| RECA-1 |
Rat ECs (1:25) |
Stromal cells from rat lymph node |
Mouse mono-IgG |
MCA970GR/Serotec |
Not appropriate for immunoblot (Duijvestijn et al., 1992) |
| SMI-71 |
Blood–brain barrier (1:100) |
Rat brain homogenate |
Mouse mono-IgM |
#SMI71/Sternberger Monoclonals |
Not appropriate for immunoblot (Sternberger and Sternberger, 1987) |
| MMP-9 |
Blood–brain barrier(1:100) |
NS0-derived, recombinant mouse MMP-9 (rmMMP-9) |
Goat poly-IgG |
AF909; lot # EFP02/R&D Systems |
Single 110 kDa band on immunoblot (Yin et al., 2006) |
