Table 1.
Elm name | Instances | Positions | Elm description | Pattern |
---|---|---|---|---|
CLV_NDR_NDR_1 | RRG | 94–96 | N-Arg dibasic convertase (nardilysine) cleavage site (Xaa-|-Arg-Lys or Arg-|-Arg-Xaa) | .RK|RR[^KR] |
CLV_PCSK_PC7_1 | RSYGRRR | 89–95 | Proprotein convertase 7 (PC7, PCSK7) cleavage site (Arg-Xaa-Xaa-Xaa-[Arg/Lys]-Arg-|-Xaa) | [R]...[KR]R. |
LIG_14-3-3_2 | RMYDSLN | 44–50 | Longer mode 2 interacting phospho-motif for 14-3-3 proteins with key conservation RxxxS#p | R..[^P][ST][IVLM]. |
RGRSSLF | 95–101 | Longer mode 2 interacting phospho-motif for 14-3-3 proteins with key conservation RxxxS#p. | ||
LIG_APCC_Dbox_1 | GRSSLFPID | 96–104 | An RxxL-based motif that binds to the Cdh1 and Cdc20 components of APC/C thereby targeting the protein for destruction in a cell cycle dependent manner | .R..L..[LIVM]. |
LIG_BRCT_BRCA1_1 | RSSLF | 97–101 | Phosphopeptide motif which directly interacts with the BRCT (carboxy-terminal) domain of the Breast Cancer Gene BRCA1 with low affinity | .S..F |
LIG_Clathr_ClatBox_1 | LFPID | 100–104 | Clathrin box motif found on cargo adaptor proteins, it interacts with the beta propeller structure located at the N-terminus of Clathrin heavy chain. | L[IVLMF].[IVLMF][DE] |
LIG_FHA_1 | AGTSRID | 33–39 | Phosphothreonine motif binding a subset of FHA domains that show a preference for a large aliphatic amino acid at the pT + 3 position. | ..(T)..[ILV]. |
PGTDNLL | 78–84 | |||
LIG_PDZ_3 | SDSL | 22–25 | Class III PDZ domains binding motif | .[DE].[IVL] |
YDSL | 46–49 | Class III PDZ domains binding motif | ||
HDPL | 66–69 | |||
TDNL | 80–83 | |||
LIG_USP7_1 | AWGSD | 19–23 | The USP7 NTD domain binding motif variant based on the MDM2 and P53 interactions. | [PA][^P][^FYWIL]S[^P] |
AGTSR | 33–37 | |||
MOD_CK1_1 | SWCTAAG | 28–34 | CK1 phosphorylation site | S..([ST])... |
MOD_Cter_Amidation | YGRR | 91–94 | Peptide C-terminal amidation | (.)G[RK][RK] |
MOD_GSK3_1 | GSDSLQDS | 21–28 | GSK3 phosphorylation recognition site | ...([ST])...[ST] |
SWCTAAGT | 28–35 | |||
NMHSLENS | 50–57 | |||
MOD_PKA_2 | VRSSLQL | 11–17 | Pka phosphorylation site | .R.([ST])... |
GRLSYPH | 71–77 | |||
GRSSLFP | 96–102 | Pka phosphorylation site | ||
MOD_PKB_1 | RRRGRSSLF | 93–101 | Pkb Phosphorylation site | R.R..([ST])... |
MOD_PLK | LENSLID | 54–60 | Site phosphorylated by the Polo-like-kinase | .[DE].[ST][ILFWMVA].. |
TRG_ENDOCYTIC_2 | YDSL | 46–49 | Tyrosine-based sorting signal responsible for the interaction with mu subunit of AP (Adaptor Protein) complex | Y..[LMVIF] |
Note: The numeric positions in column 3 are based on the following sequence investigated: NNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIM RAEHDPLKGRLSYPHPGTDNLLMLNARSYGRRRGRSLFPIDD. The letters in bold represent the 30-aa and the 8-aa regions.