Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Summed mass spectra recorded between 46 and 52 min from an on-line nanoLC-ES-MS/MS analysis of an in-gel tryptic digest of the S-layer. The quadruply charged signals at m/z 1014.07, 1111.59 and 1151.09 are molecular ions of glycopeptides of sequence GAGVVEFLLTAYPYTGNITFAPPWFIAENVVK carrying the glycans shown in the annotations. Unassigned signals are molecular ions of peptides from elsewhere in the S-layer.
