Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
The three top fluorescent sequences ranked by estimated intensity
| Sequence |
||
| 10 20 30 40 | ||
| Rank Order | Colony | ....|....|....|....|....|....|....|....| |
| - | parent | MQYKLILDGKTLKGETTTEAVDAATAEKVFKQYANDDGVD |
| 1 | Top1 | ......I.................A...F.........I. |
| 2 | Top2 | ......I.................A...F........... |
| 3 | Top3 | ......I..........I......A..T.....T....I. |
