TABLE 1.
Macaque | Route of infection | Clinical course | Variant | Time of emergence | CD4 T-cell countb | V3 loop sequence | Phenotype | Reference |
---|---|---|---|---|---|---|---|---|
BR24 | i.v. | RP | HI | 20 wpi | 229 | CTRPNNNTRKSIRIHIGPGRAFYATGDIIGDIRQAHC | R5X4 | 54 |
HR | 20 wpi | 229 | -----Y-I------HR--------------------- | X4 | ||||
CA28 | i.v. | RP | RRW.A | 11 wpi | 237 | ------------H-..RRW-.---------------- | X4 | 28 |
DG08 | i.r. | RP | Δ22-25 | 13 wpi | 314 | ---------R--H-..-------....---------- | Dual-R | 43 |
HR | 13 wpi | 314 | --------------HR--------------------- | X4 |
i.v., intravenous; i.r., intrarectal; RP, rapid progressor; wpi, weeks postinfection. For V3 sequence, dots indicate gaps and dashes stand for identity in sequences. Amino acid residues conferring CXCR4 usage are in bold type.
CD4 T cell count (per μl blood) at time of tropism variant emergence.