Table 3.
Confirmed GAPs from Arabidopsis Pollen
| Number | Protein Family | MIPS Number | AGP | C-Terminus with Predicted Cleavage Site |
|---|---|---|---|---|
| 1 | β-1,3 Glucanase | At5g64790 | − | PVQIVS GSDDFRINFVFGRFVVFGLVLLGLLTVI |
| 2 | β-1,3 Glucanase | At1g64760 | − | IQIVAS SASSFSCSSYSLVVLIVWFLLSGMMF |
| 3 | β-1,3 Glucanase | At5g58480 | − | LDTSHS SSQTPNFFQSWPLLLLFLLSGLF |
| 4 | Phytocyanin (stellacyanin like) | At5g20230 | − | TTPAGN AASSLGGATFLVAFVSAVVALF |
| 5 | Phytocyanin (early nodulin like) | At3g18590 | − | AVQFSS SGFVVSAVLIVSVFGLV |
| 6 | Phytocyanin (early nodulin like) | At1g48940 | − | TSRFLG AGLVTISILVITVFSLV |
| 7 | Fasciclin like (FLA3) | At2g24450 | + | EAEPPS SASNTGLSFGAVLVLGFVASFVGF |
| 8 | Fasciclin like (FLA14) | At3g12660 | + | PSENAG SANGVSRNDSQPAFAFTLLMSFIWWFMARLR |
| 9 | Lipid transfer protein like (LTPL) | At1g18280 | − | TAKPTS SAPAINFGGLSFASAVVATLFF |
| 10 | Auxin induced protein (AIR12) | At3g07390 | + | AGGPGN AGSLTRNVNFGVNLGILVLLGSIFIF |
| 11 | Unknown/Hypothetical Family 1 | At1g54860 | − | FTAGVA AGKATSVRVMAGLGLMGLLFSCLVLF |
Proteins were separated by one-dimensional SDS-PAGE. Proteins sensitive to Pi-PLC were identified by liquid chromatography–tandem mass spectrometry. Only identifications with >95% confidence based on MASCOT (www.matrixscience.com) scores were considered significant. The most likely cleavage sites (Udenfriend and Kodukula, 1995) are indicated (boldface). The hydrophobic domain of each C-terminal signal peptide is underlined. Confirmations have been submitted to the Munich Information Center for Protein Sequences.