Table 3.
Posttranslational modifications (PTM) in mitochondrial subpopulations from control and diabetic hearts
| Protein Diabetic IFM | Peptide Sequence Diabetic IFM | Posttranslational Modification Diabetic IFM |
|---|---|---|
| ATP synthase, H+ transporting mitochondrial F1 complex, β subunit | ALVYGQMNEPPGAR | Oxidation(M)@7; Cation:K(E)@9 |
| Ubiquinol cytochrome-c reductase core protein 2 | NALANPLYCPDYR | Carbamidomethyl(C)@9; Dioxidation(Y)@12; Arg->GluSA(R)@13 |
| Solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4 [Mus musculus] | GADIMYTGTLDCWR | Carbamidomethyl(C)@12; Dioxidation(W)@13; Arg->GluSA(R)@14 |
| Ubiquinol-cytochrome-c reductase core protein 1 | VYEEDAVPGLTPCR | Oxidation(P)@8; Oxidation(P)@12; Carbamidomethyl(C)@13; Arg->GluSA(R)@14 |
| Ubiquinol-cytochrome-c reductase core protein 1 | NALVSHLDGTTPVCEDIGR | Dioxidation(P)@12; Carbamidomethyl(C)@14; Arg->GluSA(R)@19 |
| Acetyl-coenzyme A acetyltransferase 1 | ENGTITAANASTLNDGAAALVLMTAEAAQR | Oxidation(N)@2; Deamidated(N)@9 |
| mtHsp70 (glucose-regulated protein 75) | MKETAENYLGHTAK | Oxidation(M)@1 |
| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1 | QIQDAIDMEK | Oxidation(M)@8 |
| Titin (connectin) | KMEAPPPKAPKKR | Dioxidation(P)@5 |
| NADH dehydrogenase (ubiquinone) 1β subcomplex 8 | VEDYEPYPDDGMGYGDYPMLPNR | Oxidation(D)@3 |
| Innermembrane protein, mitochondrial (mitofilin) | RVAQDWLKEAR | Deamidated(Q)@4; Oxidation(W)@6 |
| Dodecenoyl-coenzyme A δ isomerase | SLHMYLEK | Oxidation(M)@4 |
| ATP synthase, H+ transporting mitochondrial F1 complex, β subunit | TREGNDLYHEMIESGVINLK | Deamidated(N)@5 |
| ATP synthase, H+ transporting mitochondrial F1 complex, β subunit | GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR | Acetyl@N-term; Deamidated(Q)@7; Carbamidomethyl(D)@14 |
| ATP synthase, H+ transporting, mitochondrial F1 complex, α subunit, isoform 1 | VVDALGNAIDGK | Deamidated(N)@7 |
| 3-ketoacyl-CoA thiolase, mitochondrial (β-ketothiolase) | AALSAGKVPPETIDSVIVGNVMQSSSDAAYLAR | Deamidated(N)@20 |
| Mitochondrial trifunctional protein, β | DNGIRPSSLEQMAK | Deamidated(N)@2 |
| Mitochondrial trifunctional protein, β | LKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDR | Deamidated(N)@16 |
| Glutamate oxaloacetate transaminase 2, mitochondrial [Mus musculus] | DDNGKPYVLPSVR | Deamidated(N)@3 |
| Glutamate oxaloacetate transaminase 2, mitochondrial [Mus musculus] | KMNLGVGAYRDDNGKPYVLPSVR | Deamidated(N)@13 |
| Succinate dehydrogenase, Fp subunit [Mus musculus] | NTVIATGGYGR | Deamidated(N)@1 |
| Solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator) | GDQALSFLKDFLAGGIAAAVSK | Protein Terminal Acetyl@N-term |
| Solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator) | GDQALSFLK | Protein Terminal Acetyl@N-term |
| Ubiquinol-cytochrome-c reductase core protein 1 | TATFAQALQSVPETQVSILDNGLR | Deamidated(N)@21 |
| Ubiquinol-cytochrome-c reductase core protein 1 | EVESIGAHLNAYSTR | Deamidated(N)@10 |
| Cytochrome-c oxidase, subunit Va | LNDFASAVR | Deamidated(N)@2 |
| Cytochrome-c oxidase, subunit Va | RLNDFASAVR | Deamidated(N)@3; Dehydrated(D)@4 |
| Acyl-coenzyme A dehydrogenase, long-chain [Mus musculus] | SPAHGISLFLVENGMK | Deamidated(N)@13 |
| mtHsp70 (glucose-regulated protein 75) | ASNGDAWVEAHGK | Deamidated(N)@3 |
| mtHsp70 (glucose-regulated protein 75) | STNGDTFLGGEDFDQALLR | Deamidated(N)@3 |
| Fumarate hydratase 1 | YPIEHGIITNWDDMEK | Methyl(H)@5 |
| Fumarate hydratase 1 | LNDHFPLVVWQTGSGTQTNMNVNEVISNR | Deamidated(Q)@17 |
| ATP synthase, H+-transporting, mitochondrial F0 complex, subunit F | RQASGGPVDIGPEYQQDLDRELYK | Deamidated(Q)@2; Dehydrated(S)@4 |
| Pyruvate dehydrogenase E1 α 1 [Mus musculus] | TREEIQEVRSKSDPIMLLK | Deamidated(R)@9 |
| Superoxide dismutase 2, mitochondrial [Mus musculus]; Sod2 protein [Mus musculus] | FNGGGHINHTIFWTNLSPK | Deamidated(N)@2 |
| Carnitine O-acetyltransferase (carnitine acetylase) (CAT) | IWNSSLQSNKEPVGILTSNHR | Deamidated(N)@3 |
| NADH dehydrogenase (ubiquinone) 1β subcomplex, 9 [Mus musculus] | EAEEEFWQNQHPQPYIFPDSPGGTSFER | Deamidated(N)@9 |
| 3-hydroxyacyl CoA dehydrogenase | LDKFAAEHTIFASNTSSLQITNIANATTR | Deamidated(N)@14 |
| Aldehyde dehydrogenase family 6, subfamily A1 | NHGVVMPDANKENTLNQLVGAAFGAAGQR | Deamidated(N)@10 |
| Aldehyde dehydrogenase family 6, subfamily A1 | IVNDNPYGNGTAIFTTNGATAR | Deamidated(N)@9; Deamidated(N)@17 |
| Dihydrolipoamide S-succinyltransferase | NDVITVQTPAFAESVTEGDVR | Deamidated(N)@1 |
| NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 [Mus musculus] | MMNGRPGHEPLK | Protein Terminal Acetyl@N-term; Deamidated(N)@3 |
| Isocitrate dehydrogenase 3 (NAD+), γ | KAVLASMDNENMHTPDIGGQGTTSQAIQDII | Deamidated(N)@9 |
| ATP synthase, H+ transporting mitochondrial F1 complex, β subunit | IPSAVGYQPTLATDMGTMQER | Oxidation(P)@2 |
| Acetyl-coenzyme A acyltransferase 2 | VPPETIDSVIVGNVMQSSSDAAYLAR | Oxidation(P)@2 |
| Ubiquinol-cytochrome-c reductase core protein 1 | VYEEDAVPGLTPCR | Dioxidation(P)@12; Carbamidomethyl(C)@13; Arg->GluSA(R)@14 |
| Ubiquinol-cytochrome-c reductase core protein 1 | TATFAQALQSVPETQVSILDNGLR | Oxidation(F)@4; Deamidated(Q)@6; Deamidated(N)@21 |
| NADH dehydrogenase (ubiquinone) 1β subcomplex 8 [Mus musculus] | VEDYEPYPDDGMGYGDYPMLPNR | Oxidation(D)@3 |
| ATP synthase, H+ transporting, mitochondrial F1 complex, α subunit, isoform 1 | VVDALGNAIDGK | Deamidated(N)@7 |
| Enoyl-coenzyme A hydratase (trifunctional protein), α subunit | SLNSEMDNILANLRLPAKPEVSSDEDVQYR | Deamidated(N)@3 |
| Glutamate oxaloacetate transaminase 2, mitochondrial [Mus musculus] | ILIRPLYSNPPLNGAR | Deamidated(N)@13 |
| Glutamate oxaloacetate transaminase 2, mitochondrial [Mus musculus] | MNLGVGAYRDDNGKPYVLPSVR | Deamidated(N)@12 |
| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d | NIIPFDQMTIDDLNEIFPETKLDKK | Deamidated(N)@1 |
| Electron transfer flavoprotein-ubiquinone oxidoreductase | IPVPILPGLPMNNHGNYIVR | Deamidated(N)@12 |
| Oxoglutarate dehydrogenase (lipoamide) | SSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIR | Deamidated(Q)@10 |
| Ubiquinol cytochrome-c reductase core protein 2 [Mus musculus] | LPNGLVIASLENYAPLSR | Deamidated(N)@3 |
| Ubiquinol cytochrome-c reductase core protein 2 [Mus musculus] | RGNNTTSLLSQSVAK | Deamidated(N)@3 |
| Ubiquinol cytochrome-c reductase core protein 2 [Mus musculus] | TSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSR | Deamidated(Q)@13; Deamidated(N)@22 |
| Fumarate hydratase 1 | LNDHFPLVVWQTGSGTQTNMNVNEVISNR | Deamidated(Q)@17 |
| Cytochrome-c-1 | AANNGALPPDLSYIVR | Deamidated(N)@4 |
| Carnitine palmitoyltransferase 2 | LSAVSGPAEYLQHSIVPTMHYQDSLPR | Deamidated(Q)@12 |
| NADH dehydrogenase (ubiquinone) 1α, subcomplex 8 | TDRPLPENPYHSR | Dehydrated(S)@12; Deamidated(R)@13 |
| Pyruvate dehydrogenase E1 α1 | KEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVR | Deamidated(Q)@8 |
| Pyruvate dehydrogenase E1 α1 | MVNSNLASVEELKEIDVEVR | Deamidated(N)@3 |
| Pyruvate dehydrogenase E1 α1 | TREEIQEVRSKSDPIMLLK | Deamidated(R)@9 |
Multidimensional protein identification technology (MudPIT) was used to identify posttranslational modifications (PTM) of proteins from SSM and IFM from control and diabetic mitochondria. Peptides presented represent only those peptides that have PTMs in the diabetic SSM or diabetic IFM and not present in the control group.