Table 3.

Summary of block chemistries, synthesis and properties of conjugated block copolymers with coiled-coil forming sequences.

	A Block	B Block	Synthesis	Mw, kDa	Morphologies	Secondary Structure	Solvent	Techniques	Size	Applications	References
1	PEG77	(KIAALKE)3G	Fmoc solid phase synthesis	6	soluble protein N/A	random coil	DMF/PBS	CD, DLS, cryo-TEM	N/A	nanomaterials	Marsden et al., 2008
2	PS11	G(EIAALEK)3	Fmoc solid phase synthesis	3.3	spherical	α-helix	DMF/PBS	CD, DLS, cryo-TEM	15 ± 2 nm	nanomaterials	Marsden et al., 2008
3	PS - PEG	G(EIAALEK)3/(KIAALKE)3G	Fmoc solid phase synthesis	9.1	rod-like	coiled-coil	DMF/PBS	CD, DLS, cryo-TEM	L = 42 ± 10 nm; W = 8 ± 1 nm	nanomaterials	Marsden et al., 2008
4	PEG	IDFISTYITKIDKKIQSIEDIIHQIENKISEIKQLIK	Fmoc solid phase synthesis followed by cystein-maleimide chemistry	8.1 and 1.2	hydrogel	α-helix to coiled-coil	PBS	CD, AUC	N/A	engineering, controlled therapeutic release, and in vitro cell expansion	Jing et al., 2008
5	PEG	GEAK(LAEIAK)2LAEIYA	Fmoc solid phase peptide synthesis followed by Pegylation	3.3 and 4.2	thin layers of aggregates with nanosized features	α-helical coiled-coil motif	PBS	CD, AUC, EPR, AFM	H = 1 nm; D = 10 nm	nanomaterials	Vandermeulen et al., 2004; Vandermeulen et al., 2003
6	PEG3400	IEEEVEKEVQRLEFEVQALEKEVAEYQEGI and TEEEVRKRVQRLRFRVQALRKRVAEYQEGI	Fmoc solid phase peptide synthesis followed by PEGylation	m = 15; Mw >100kDa	micelles, hydrogels	α-helix, coiled-coil	PBS	CD, AUC, DLS, SLS	Rh = 55 nm; Rg = 62 nm	hydrogels, drug delivery systems	Sahin and Kiick, 2009
7	(HPMA) and (DAMA)	6H-(random coil block)-(VSSLESK)6	Genetic Engineering	1 block 1 peptide	hydrogel	α-helix to coiled coil	PBS	CD	N/A	drug delivery systems	Tang et al., 2001