Skip to main content
. Author manuscript; available in PMC: 2012 Feb 14.
Published in final edited form as: Biomacromolecules. 2011 Jan 14;12(2):269–289. doi: 10.1021/bm100928x

Table 6.

Summary of block chemistries, synthesis and properties of protein-based block copolymers.

Origin A Block B Block Synthesis Mw, kDa Morphologies Secondary Structure Solvent Techniques Size Applications References
Silk-based
1 silkworm silk block: [(GAGAGS)9]12 Cell attachment domain of human fibronectin Genetic Engineering 95 woven sheaves microstructures crystalline β-sheets formic acid (88 %) WAXS, TEM, SAED W= 12 ± 2 nm tissue engineering and regenerative medicine Anderson et al., 1994
[GAAVTGRGDSPASAAGY]12
2 silk-like block I: [(GA)3GE]28 silk-like block II: [(GA)3GL]28 Genetic Engineering 32 fibrils stacks of β-sheets, β-turns formic acid (70 %) FTIR, CD, tensiometry, AFM H = 1.5 - 7.5 nm; W = 20 - 30 nm biomedical applications Werten et al., 2008
silk-like block I: [(GA)3GE]24 silk-like block II: [(GA)3GE]24 Genetic Engineering 28 fibrils β-sheets and β-turns formic acid (70 %) FTIR, CD, tensiometry, AFM H = 1.5 - 7.5 nm; W = 20 - 30 nm biomedical applications Werten et al., 2008
3 spider silk block from A. diadematus: (AEAEAKAK)2 spider silk block from A. diadematus: (GPGQQ)6 Genetic Engineering 44 fibril network antiparallel β-sheets and β-turns aqueous solution HRSEM, FTIR, CD, NMR D = 10 - 20 nm tissue engineering Qu et al., 2000
spider silk block from N. clavipes: (SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT)6 (K)15,30,45 Genetic Engineering 23, 25, and 27 films β-sheets HFIP/water DLS, AFM, cell viability assay gene delivery Numata et al., 2009
4 hydrophobic block from N. clavipes dragline silk: (GAGAAAAAGGAG)1-6 hydrophilic block from N. clavipes dragline silk: QGGYGGLGSQGSGRGGLGGQ Genetic Engineering 8 - 13 nanofibers, bowl-shapwed micelles, polymerosomes antiparallel β-sheets aqueous solution FTIR, AFM, SEM D1 = 1-3 μm; D2 = 70μm; W= 400 nm controlled drug delivery, tissue engineering, and biosurface engineering Rabotyagova et al., 2009

Silk-Elastin
1 [GAGAGS]11 [GXGVP)9]11 Genetic Engineering 47 hydrogels N/A PBS microrheology N/A drug delivery Nagarsekar et al., 2002
2 [(GAGAGS)4]12(GAGAGS) [(GXGVP)8]13 Genetic Engineering 70 hydrogels N/A aqueous solution turbidity assay, DNA release study N/A controlled gene delivery system Megeed et al., 2002
3 GAGAGS GVGVP Genetic Engineering 55 - 87 hydrogels N/A PBS microrheology, DSC N/A controlled gene delivery system Haider et al., 2005

Others
1 spider silk block: GGAGQGGYGGLGGQGAGRGGLGGQGAGAAAA Collagen block: (GXY)r Genetic Engineering 57 - 60 fibers* (ongoing study) N/A N/A N/A N/A biomedical applications Teule et al., 2003
2 (KHKHKHKHKK)6 FGF2 represents human fibroblast growth factor 2 Genetic Engineering 27 microparticles N/A PBS cell proliferation assay, cell toxicity assays, photon correlation spectroscopy (PCS) D = 230; 500; 800 nm* non-viral gene delivery Hatefi et al., 2006
3 coiled-coil block: (ISSLESK)-(IYYLEYK)2-(ISSLESK) random coil: [(AG)3PEG]10 Genetic Engineering 14 - 20 hydrogels α-helical coiled-coil PBS CD, AUC, SEM, microrheology N/A drug delivery systems Xu and Kopecek, 2008
COMP block: DLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMESDASG elastin block: [(VPGVG)2VPGFG(VPGVG)2]5 Genetic Engineering 22, 23, and 35 aggregates random coils or β-spirals PBS far-UV CD, DLS, SALS Rh = 60-80 nm “smart” biomaterials Haghapanah et al., 2009
4 leucine zipper block: LGHELAEHKKKLAQLKSELAALKKELAEWE random coil block: (GAGAGAGPE)10 Genetic Engineering 18 hydrogels disorderd central domain, helical conformation of the end blocks PBS CD, confocal microscopy, surface absorption and cell response assays N/A cell-cpecific surface coatings Fischer et al., 2007
5 (APQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMESDAS) and coiled-coil leucine zipper block (SGDLENEVAQLEREVRSLEDEAAELEQKVSRLKNEIEDLKAE) (AGAGAGPEG)10 Genetic Engineering 20 - 22 hydrogels α-helical coiled-coil aqueous solution DLS, microrheology N/A tissue engineering materials Shen et al., 2006