. Author manuscript; available in PMC: 2011 May 31.

Published in final edited form as: Anal Chem. 2010 Jul 15;82(14):6154–6162. doi: 10.1021/ac100956x

Table 2.

Determination of the extent of 2-chain cleavage (between R275 and I276) of TNK-tPA using either Lys-C digested peptide fragments or in-gel digestion of the resolved single and 2-chain forms.

Product / Method	Innovator	Follow-on
Lys-C digestion (% 2-chain form)	40 (±2) %	8 (±1) %
In-gel Analysis (% 2-chain form)	40 (±5) %	10 (±3) %

Lys-C digested peptide with and without 2-chain cleavage: NRRLTWEYCDVPSCSTCGLRQYSQPQFR (248–275)

NRRLTWEYCDVPSCSTCGLRQYSQPQFRIK (248–277)

Average of 3 measurements