Skip to main content
. 2011 Oct 28;6(10):e26367. doi: 10.1371/journal.pone.0026367

Table 2. Sequence and activity of variegin and its variants.

Name Sequence Pre-incubation tine (min) IC50 (nM) Ki (nM) Mechanism Plots shown in figure
s-variegin SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES 0 8.25±0.45 0.318±0.020 Fast, tight-binding, competitive Published [17]
20 10.4±0.3
EP25 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES 0 173±26 0.365±0.109 Slow, tight-binding, competitive S3
20 13.1±0.7
MH22 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES 0 11.5±0.7 14.1±0.3 Fast, tight-binding, noncompetitive Published [17]
20 12.3±1.9
Hirulog-1 D FPRPGGGGNGDFEEIPEEYL 0 72.6±3.9 2.94±0.12 Fast, tight-binding, competitive Published [17]
10 102±13
EP21 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES 0 177±7 0.315±0.024 Slow, tight-binding, competitive S4
20 16.2±2.9
MH18 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES 0 10.9±1.2 14.9±3.5 Fast, tight-binding, noncompetitive S5
20 11.7±1.9
DV24 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES 0 7.49±0.28 0.306±0.029 Fast, tight-binding, competitive S7
20 10.1±0.6
DV24H12A SDQGDVAEPKMAKTAPPFDFEAIPEEYLDDES 0 48.2±12.4 3.23±0.48 Fast, tight-binding, competitive S8
20 141±11
MH18H12A SDQGDVAEPKMAKTAPPFDFEAIPEEYLDDES 0 328±23 329±8 Fast, tight-binding, noncompetitive S9
20 343±46
DV24K10R SDQGDVAEPRMHKTAPPFDFEAIPEEYLDDES 0 6.98±0.76 0.259±0.015 Fast, tight-binding, competitive S10
20 12.0±0.4
DV23 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES 0 45.4±1.6 2.19±0.23 Fast, tight-binding, competitive S11
20 77.8±6.1
DV23K10R SDQGDVAEPRMHKTAPPFDFEAIPEEYLDDES 0 12.9±1.0 0.600±0.010 Fast, tight-binding, competitive S12
20 102±1
EP25A22E SDQGDVAEPKMHKTAPPFDFEEIPEEYLDDES 0 124±23 0.311±0.070 Slow, tight-binding, competitive S13
20 13.5±2.1
MH22A22E SDQGDVAEPKMHKTAPPFDFEEIPEEYLDDES 0 13.6±0.5 15.1±1.0 Fast, tight-binding, noncompetitive S14
20 15.6±0.4
DV24Yphos SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDE 0 8.67±0.45 0.327±0.032 Fast, tight-binding, competitive S15
20 12.4±1.2
DV24K10RYphos SDQGDVAEPRMHKTAPPFDFEAIPEEYLDDES 0 4.64±0.78 0.150±0.018 Fast, tight-binding, competitive S16
20 7.80±1.80
DV24Ysulf SDQGDVAEPKMHKTAPPFDFEAIPEEY*LDDE 0 1.66±0.18 0.0560±0.0180 Fast, tight-binding, competitive S17
20 2.02±0.29
DV24K10RYsulf SDQGDVAEPRMHKTAPPFDFEAIPEEY*LDDE 0 1.39±0.17 0.0420±0.0061 Fast, tight-binding, competitive S18
20 1.66±0.21
MH18Ysulf SDQGDVAEPKMHKTAPPFDFEAIPEEY*LDDES 0 1.26±0.18 1.25±0.18 Fast, tight-binding, noncompetitive S19
20 1.17±0.14

Y: phosphotyrosine; Y*: sulfotyrosine.