TABLE 5.
Identification of the minimal CD4+ T-cell epitope recognized by C97 Th-cell clones
| Peptide | Amino acid sequencea | SIe
|
|
|---|---|---|---|
| 4C9f | 3G5f | ||
| Expt 1 | |||
| P1 | DQEVIIDEQTGLPIKSHDYSEKPSVIYKPS | 20.7 | 51.8 |
| P1-1 | DQEVIIDEQTGLPIKS | 31.2 | 52.9 |
| P1-2 | PIKSHDYSEKPSVIY | 1.4 | 1.1 |
| P1-3 | EQTGLPIKS | 0.9 | 1.1 |
| P1-4 | DEQTGLPIKS | 5.4 | 18.5 |
| P1-5 | IDEQTGLPIKS | 25.5 | 37.6 |
| P1-5ΔS | IDEQTGLPIK | 1.4 | 0.2 |
| P1-5ΔKS | IDEQTGLPI | 1.1 | 0.4 |
| Expt 2 | |||
| BboP1-4 | DEQTGLPIKS | 10.3 | 34.8 |
| BbgP1-4b | DEQTGLPVKN | 0.8 | 15.0 |
| P1-4Nc | DEQTGLPIKN | 5.7 | 18.3 |
| P1-4Vd | DEQTGLPVKS | 0.8 | 41.2 |
The minimal T-cell epitope that stimulated CD4+ T cell clones is underlined.
Amino acid sequence of B. bigemina Hsp20 corresponding to P1-4. Amino acid residues in bold type indicate differences between the B. bovis and B. bigemina Hsp20 epitopes.
Replacement of the serine residue with an asparagine residue (bold type).
Replacement of the isoleucine residue with a valine residue (bold type).
SI, stimulation index (mean counts per minute of cells stimulated with 1 μg of Hsp20 peptide per ml/mean counts per minute of control MSP2 peptide). SI values of >3.0 are considered positive and are shown in bold type.
Hsp20-specific CD4+ T-cell clones described previously (13).