Table 1.
Peptide/Source | Sequence | In vitro study |
---|---|---|
α-Helical | ||
Aureins Southern bell frog |
GLFDIIKKIAESF (aurein 1.2) |
60 cancer cell lines tested (human tumor line testing program of the US National Cancer Institute) (∼50 active) (Rozek et al., 2000) |
BMAP-27/BMAP-28 Bovine |
GRFKRFRKKFKKLFKKLSPVIPLLHLG/ GGLRSLGRKILRAWKKYGPIIVPIIRIG |
Human tumor cells, leukemic cells (Risso et al., 1998) |
Cecropin A Hyalophora cecropia Cecropin B Chinese oak silk moth |
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL |
Bladder cancer (Suttmann et al., 2008) Leukemia (Chen et al., 1997), bladder cancer (Suttmann et al., 2008) |
Citropins Australian blue mountains tree frog |
GLFDVIKKVASVIGGL (Citropin 1.1) |
60 human cancer cell lines (human tumor line testing program of the US National Cancer Institute) (Doyle et al., 2003); human histiocytic lymphoma cell line (Koszalka et al., 2011) |
Epinicidin-1 Fish |
GFIFHIIKGLFHAGKMIHGLV | Human lung carcinoma, cervix adenocarcinoma, hepatocellular carcinoma, fibrosarcoma, histiocytic lymphoma cells (Lin et al., 2009) |
Gaegurin-6/-5 Korean wrinkled frog |
FLPLLAGLAANFLPTIICKISYKC | Human lung, prostate, liver, kidney and breast cancer cell lines (Kim et al., 2003) |
LL-37 Homo sapiens |
[LL-37, 37 aa] | Jurkat human T leukemia cells, HeLa cells (Mader et al., 2009) |
Magainins African clawed frog Pexiganan (MSI-78) |
GIGKFLHSAKKFGKAFVGEIMNS (Magainin 2) GIGKFLKKAKKFGKAFVKILKK |
Hematopoietic cell lines (Cruciani et al., 1991), Ehrlich ascites tumor cells, human adenocarcinoma (Baker et al., 1993), bladder cancer line (Lehmann et al., 2006), histiocytic lymphoma cell line (Koszalka et al., 2011) |
Melittin Honey bee venom |
GIGAVLKVLTTGLPALISWIKRKRQQ | Human hepatocellular carcinoma (Wang et al., 2009a); osteosarcoma (Chu et al., 2007); leukemic cells (Moon et al., 2008); prostate and ovarian (Holle et al., 2003), neuroblastoma cancer cells (Drechsler and Andrä, 2011) |
NK-2 Porcine leukocytes NKCS and derivatives |
KILRGVCKKIMRTFLRRISKDILTGKK KILRGVSKKIMRTFLRRISKDILTGKK |
Human lymphocytes and seven human cancer cell lines (Schröder-Borm et al., 2005); human neuroblastoma cancer cells (Drechsler and Andrä, 2011) Human prostate carcinoma cells (Manavbasi et al., 2010) |
Pep27 Strep. pneumonia |
MRKEFHNVLSSGQLLADKRPARDYNRK | Leukemia cell lines (Lee et al., 2005) |
Polybia-MPI P. paulista |
IDWKKLLDAAKQIL | Human bladder cancer and prostate cancer cell line (Wang et al., 2008) |
Temporin A Frog Rana temporaria |
FLPLIGRVLSGIL | Human histiocytic lymphoma cell line (Koszalka et al., 2011) |
β-sheet | ||
Buforin II Bufo bufo gargarizans |
TRSSRAGLQFPVGRVHRLLRK | 62 cell lines (Lee et al., 2008); human histiocytic lymphoma cell line (Koszalka et al., 2011) |
Human α-defensins Homo sapiens Defensins |
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (HNP1) Diverse sequences |
Human lung adenocarcinoma (Xu et al., 2008) HeLa, glioma, kidney cancer, lung cancer, myeloma (Iwasaki et al., 2009) |
Gomesin A. gomesiana |
ECRRLCYKQRCVTYCRGR | Breast and colon adenocarcinoma, HeLa (Rodrigues et al., 2002) |
Lactoferricin B Bovine |
FKCRRWQWRMKKLGAPSITCVRRAF | Neuroblastoma (Eliassen et al., 2006), melanoma, mammary carcinoma, colorectal adenocarcinoma (Eliassen et al., 2003) |
Protegrin-1 porcine |
RGGRLCYCRRRFCVCVGR | Human histiocytic lymphoma cell line (Koszalka et al., 2011) |
Tachyplesin I Southeast Asian horseshoe crab |
KWCFRVCYRGICYRRCR | Human gastric adenocarcinoma (Shi et al., 2006); human hepatocarcinoma cells (Li et al., 2003); |
Others | ||
PR-39 Porcine small intestine |
RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Human hepatocellular carcinoma cells (Ohtake et al., 1999) |
Alloferon-1/-2 Insects |
HGVSGHGOHGVHG/GVSGHGVHG | Mice (IFN-production) (Chernysh et al., 2002) |
Dolastatin 10 D. auricularia |
Dov-Val-Dil-Dap-Doeb | Murine PS leukemia cells (Pettit et al., 1987) |
For a complete list of anticancer peptides check http://aps.unmc.edu/AP/database/antiC.php.
Dolavaline (Dov), dolaisoleuine (Dil), dola-proine (Dap), dolaphenine (Doe).