Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Top score reconstruction of SDP from a triply charged mass spectrum. Correct reconstruction is shown in bold.
| Peptide | Structure | NScore | Score | PME | protein | position | length |
|---|---|---|---|---|---|---|---|
| CGLYAVCVAAGYLYVVGVNAVALQTAAAVTTAVWKYVAKYSS | linear | 8.17 | 48 | 0.24 | sp|o34344|sdpc-bacsu | 140 | 42 |
| SVFFLWILNFVIGFAFPILLSSVGLSFTFFIFVALGVLA | linear | 4.44 | 28 | 0.44 | sp|p94493|yncc-bacsu | 393 | 39 |
| ELPGDLIARAQDILKELEHSGNKPEVPVQKPQVKEEPAQ | cyclic | 4.05 | 316 | 0.30 | sp|p49849|muts-bacsu | 767 | 39 |
