Skip to main content
. 2011 Aug 23;2011:656051. doi: 10.4061/2011/656051

Table 1.

The peptides, derivatives of signal proteins, and their biological activity.

Signal protein Sequence Activity References
α 2-AR (C-ICL3) RWRGRQNREKRFTC361-373 and its dimeric constrain with N-ICL3-peptide RIYQIAKRRTR233-243 Both selectively stimulate Gi/o proteins and inhibit α 2-AR agonist-stimulated GTPase activity [3032]

β 2-AR (C-ICL3) RRSSKFCLKEKKALK259-273 Selectively stimulates Gs proteins and decreases regulatory effects of β 2-AR agonists [3335]

D1-DR (C-ICL3, I), 5-HT6R (C-ICL3, II) FKMSFKRETKVLKTLSV260-276 (I); KHSRKALKASL258-268K (II) Stimulate Gs proteins and AC activity, decrease the stimulating effects of D1-DR (peptide I) and 5-HT6R (II) on AC system [38, 39]

D2-DR (N-ICL3, I), 5-HT1AR (N-ICL3, II); 5-HT1BR (C-ICL3, III); 5-HT1DR (N-ICL3, IV; C-ICL3, V); m4-MChR (C-ICL3, VI) VYIKIYIVLRRRRKRVNTK206-224 (I); LYGRIFRAARFRIRKTVK214-231 (II); ARERKATKTL307-316 (III);
LYGRIYVAARSRI213-225 (IV);
RKRISAARERKATK285-298 (V);
RNQVRKKRQMAARERKVTR382-400 (VI)
Selectively activate Gi/o proteins and inhibit forskolin-stimulated AC activity in the absence of hormone; inhibit signaling via their cognate Gi/o-coupled receptors [30, 32, 3942]

m3-MChR (C-ICL3) LVKEKKAAQTLSAILL483-497 Selectively activates Gq and influences m3-MChR-mediated signaling [43]

δ-opioid receptor (ICL3) MGRLRSVRLLSGSKEKDRSLRRITR237-261 Blocks δ-agonist-induced PLC activation, Ca2+ release and cAMP signaling [45]

Luteinizing hormone receptor; FSH receptor (C-ICL3, II); relaxin receptor RXFP1 (C-ICL3, III); parathyroid hormone receptor (C-ICL3, IV) FAVQNPELMATNKDTKIAKK551-570 (I),
HIYLTVRNPNIVSSSSDTRIAKR533-555 (II),
and EIRNQVKKE(Nle)ILAKR615-629 (III)
and their short analogs; EYRKLLK402-408 (IV)
Activate preferably Gs proteins and stimulate the basal AC activity, inhibit agonist-induced signaling via their cognate receptors [4652]

GLP1R (ICL1 and ICL3) FRHLHCTR169-176; IVIAKLKANLMCKTDIKCRLAK330-351 Activate preferably Gs and Gi proteins, inhibit hormone- stimulated AC activity [53]

V2-vasopressin receptor (ICL3) Cyclo-QVLIFREIHASLVPGPSERAG-RRRRGRRTGSPSEGAHVSAAMAKT-VRMT225-273 Decreases the affinity of agonist for the receptor and inhibits vasopressin-stimulated AC activity [55]

CB1-cannabinoid receptor (N-ICL3, I; C-ICL3, II, and N-CTD, III) KAHSHAVRMIQRGTQKS301-317 (I); QVTRPDQARMDIRLAK329-344 (II); RSKDLRHAFRSMFPSCE401-417 (III) Selectively stimulate different isoforms of the α-subunits of Gi proteins and significantly inhibit AC activity [5658]

Angiotensin II receptor of the type 1 (ICL2, I; N-ICL3, II; C-ICL3, III, N-CTD, IV) DRYLAIVHPMKSR125-137 (I); TLIWKALKKAYEIQKN216-231 (II); KNKPRNDDIFRI230-241 (III); FLGKKFKKYFLQL304-316 (IV) Inhibit angiotensin-induced activation of G proteins and the effector enzymes; peptide II selectively activates Gi/o proteins, peptide III Gq/11 proteins [5962]
FPR1 (ICL2, I; N-CTD, II) CVLHPVWTQNHR126-137 (I); FRERLIHALPASLER308-322 (II) Activate in a PTX-dependent manner Gi proteins; peptide II inhibits high affinity agonist binding to the receptor and its coupling to Gi protein [63, 64]

Prostacyclin receptor (ICL1) SARRPARPSAFAV39-51 Selectively stimulates Gs proteins and the basal activity of AC [65, 66]

Insulin receptor (tyrosine kinase region) N-stearyl-TRDIYETDYYRK1142-1153 Increases insulin- and vanadate-stimulated phosphorylation of IR; significantly enhances insulin-induced stimulation of PI3K and MAPK activities [67]

Insulin receptor (C-terminal region) N-stearyl-SSHCQREEAGGRDGG1293-1307 Enhances insulin-stimulated autophosphorylation; increases insulin-stimulated PI3K and MAPK activities [68]

EGF receptor (N-terminal region of the juxtamembrane domain) RRREIVRKRTLRR646-658 Activates Gs proteins, influences activity of Gi proteins [69]

NPR-C (cytoplasmic domain) KKYRITIERRNH461-472;
RRNHQEESNIGK469-480;
RRNHQEESNIGKHRELR469-485;
HRELREDSIRSH481-492 and their analogs
Inhibit the basal, forskolin- and hormone-stimulated AC activity; selectively increase GTP binding activity of Gi1 and Gi2 proteins; stimulate PLCβ3 activity; inhibit hormone-stimulated DNA synthesis in vascular smooth muscle cells; induce smooth muscle contraction [7072]

NPR-C (extreme C-terminal region of the cytoplasmic domain) GKHRELREDSIRSHFSVA479-496 Inhibits ANP(4–23)-induced Gi protein activation and cellular responses acting as a competitive inhibitor of ANP(4–23)-mediated signaling [71]

Gα t IKENLKDCGLF340-350 Stabilizes the active state of opsin and meta-II-rhodopsin and meta-Ib-rhodopsin; [7376]

Gα s RVFNDARDIIQRMHLRQYELL374-394 and its short analogs Inhibit transduction of hormonal signal via Gs-coupled receptors [77]

Gα s (Switch I and II regions, resp.) RCRVLTSGIFETKFQVDK199-216; FDVGGQRDERRKWIQ-CFNDVTAIIFV222-247 Increase the basal and forskolin-stimulated AC2 and AC6 activities; inhibit Gα s-stimulated activity of both AC isoforms; behave as partial agonist [78]

Gα s (α3-β5 region) EALNLFKSIWNNRWL-RTIS268-286 Inhibits the basal and forskolin-stimulated activities of AC2 and AC6; significantly decreases the Gα s-stimulated enzyme activity [78]

AC1 (C1b subdomain) IKPAKRMKFKTVCYLLVQLMHCRKMF-KA495-522 (pAC28, C1b) Binds CaM with high affinity in a Ca2+-independent manner; inhibits CaM-stimulated AC activity with IC50 equal to 500 nM [79, 80]
AC1 (C2a subdomain) TEEVHRLLRRGS-YRFVCRGKV1024-1044 (pVLG, C2a) Binds CaM with low affinity in a Ca2+-dependent manner; inhibits CaM-stimulated AC activity with IC50 is 10 μM [80]

AC2 (C2 domain) YTESDVNKEGLECLRLLNEIIADFD-DLL899-926 (α2, I);
SKPKFSGVEKIKTIGSTYMAAT927-948 (β2-β3, II);
DAINKHSFNDFKLRVGINHGPVIA-GVIGAQK984-1015 (α3-β4, III)
All peptides inhibit Gα s- and forskolin-stimulated activities of AC2 and AC6; peptides I and III inhibit the basal AC activity; peptide I decreases Mn2+-stimulated activity [81]

AC6 (C1 domain) AAENHCLRIKILGDCYYC427-444 (α2-β2-β3, I); IHSGRVHCGVLGLRKWQFDVWSN-DV487-511 (β4-β5-α4, II) Both peptides inhibit Gα s- and forskolin-stimulated AC activities; peptide II inhibits the basal activity of both AC2 and AC6 [81]

PLCβ1b N-Myristoyl-TPPNPQALKW1164-1173 (I);
GEGSSSVLSESCHEDPSVPPNFTPP-NPQALKW1142-1173 (II)
Both peptides dissociate the enzyme from membrane and inhibit PLC stimulation by hormones; peptide II prevents cardiomyocytes hypertrophy [82, 83]

PLCβ3 QEENTQL1161-1167 Significantly inhibits intracellular calcium response to selective agonists of mGluR [84]

PLCγ GLYRKAMRLRYPV724-736, and its N-myristoylated analogs Specifically inhibit PLC activity and PLC-dependent cellular processes [85]

PLCδ1 (IQ-peptide) VRSQVQHKPKEDKLKLVPELS473-493 Inhibits PLC activity; binds CaM in Ca2+-independent manner [86]

PLCδ1 N-Myristoyl-TIPWNSLKQGYRHVHLL747-763 Inhibits FSH-induced Ca2+ influx [87]

Regulatory p85-subunit of PI3K (C-terminal region of N-terminal SH2 domain) WNVGSSNRNKAENLLRGKR11-29 Exhibits binding specificity and affinity for PI 3,4,5-P3 and inhibits PI 3,4,5-P3-binding to the p85 subunit [88]

PKCζ (pseudosubstrate region) N-Myristoyl-SIYRRGARRWRKL114-126 Inhibits PKCζ activity; stimulates Akt, ERK1/2, p38 MAPK and eNOS activity [89]

PKCη (pseudosubstrate region) N-Myristoyl-RKRQRAMRRRVHQING156-171 Inhibits PKCη activity; stimulates eNOS phosphorylation [89]