Table 1.
Yeast strains and plasmids used in this study
| Strain or plasmid | Description |
|---|---|
| Strains | |
| W303-1a (NOY388) | MATaade2-1 ura3-1 trp1-1 leu2-3,112 his3-11,15 can1-100 |
| NOY654 | Mat ade2-1 ura3-1 trp1-1 leu2-3,112 his3-11,15 can1-100 rpa135Δ::LEU2, pNOY302 |
| NOY798 | MATα ade2 ura3 trp1 leu2 his3 can1 rrn5::TRP1, pNOY402 |
| NOY886 | MATα rpa135Δ::LEU2 ade2-1 ura3-1 his3-11,15 trp1-1 leu2-3,112 can1-100 fob1Δ::HIS3, pNOY117 [CEN, RPA135, TRP1]; rDNA copy number ∼40 (French et al., 2003) |
| NOY1075 | MATaade2-1 ura3-1 trp1-1 leu2-3,112 his3-11,15 can1-100 rrn3 (S213P) |
| NOY1170 | MATα ade2-1 ura3-1 trp1-1 leu2-3,112 his3-11,15 can1-100 rrn3Δ::HIS3, pNOY452 |
| Plasmids | |
| pNOY302 | A derivative of pRS314 (CEN6 ARSH4 TRP1) carrying triple HA-tagged RPA135; the DNA sequence inserted after the initiation codon AUG encodes the following amino acids: GGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAQCGR (HA peptide underlined). |
| pNOY402 | A derivative of pRS315 (CEN6 ARSH4 LEU2) carrying triple HA- and (His)6-tagged RRN5 [RRN5-(HA)3-His)6]; see Keener et al. (1997). |
| pNOY452 | A derivative of pRS315 (CEN6 ARSH4 LEU2) carrying RRN3 tagged with (HA)7 at the N terminus. |